Nosocomiicoccus massiliensis: CJ229_000460 Help Entry CJ229_000460      CDS       T09499                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism nmy  Nosocomiicoccus massiliensis Pathway nmy01100   Metabolic pathways nmy01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:nmy00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CJ229_000460    00074 Mycolic acid biosynthesis     CJ229_000460   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CJ229_000460 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C DUF2501 Guanylate_cyc Motif Other DBs NCBI-ProteinID:  WOS96248 UniProt:  A0AAF1BRQ5 LinkDB All DBs Position 86567..86803 Genome browser AA seq 78 aa AA seqDB search MDNFDKIKDIIVDKLGIDEDQVTKDATFKDDLGADSLDIAELVMELEDEFDTEIPDEEAE KIVTVGDALDFIEKLENQ NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atggataattttgataaaattaaagacattattgtcgacaaattaggtatcgatgaggat caagtgacgaaagatgcgactttcaaagatgaccttggtgcggactctttagacattgcg gaacttgtaatggaattagaagatgagttcgatactgagattccagatgaggaagctgag aaaatcgttactgttggtgatgctttagatttcatcgagaagcttgaaaaccaataa

DBGET integrated database retrieval system