Candidatus Nitrospira neomarina: PQG83_14340 Help Entry PQG83_14340       CDS       T09428                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism nneo  Candidatus Nitrospira neomarina Brite KEGG Orthology (KO) [BR:nneo00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:nneo03032]     PQG83_14340    03036 Chromosome and associated proteins [BR:nneo03036]     PQG83_14340    03400 DNA repair and recombination proteins [BR:nneo03400]     PQG83_14340 DNA replication proteins [BR:nneo03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     PQG83_14340 Chromosome and associated proteins [BR:nneo03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     PQG83_14340 DNA repair and recombination proteins [BR:nneo03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       PQG83_14340 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding A_thal_3526 HU-CCDC81_euk_2 Motif Other DBs NCBI-ProteinID:  WNM60931 UniProt:  A0AA96JZA8 LinkDB All DBs Position complement(3338269..3338559) Genome browser AA seq 96 aa AA seqDB search MGKAMTKSQIADHLAKKADVTKKIATQILDDFAALAYKEAKNAFVVPGIGKLVLAHRKAR MGRNPQTGAAIKIPAKRVVKFRVAKAAKDAILGVKK NT seq 291 nt NT seq  +upstreamnt  +downstreamnt atgggaaaggccatgacaaagtcgcagattgccgatcacctggctaaaaaagcggatgtt accaagaaaattgccacgcaaattcttgatgattttgctgcgttggcttacaaggaagcc aaaaatgcgtttgtggtacctggaatcggcaagttggtccttgcacaccgaaaagccaga atgggcagaaatccccaaactggagctgcgattaaaatcccagccaaacgtgtcgtgaag ttccgcgtagccaaggcggctaaagatgcgatcttgggggttaaaaagtaa

DBGET integrated database retrieval system