Nipponia nippon (crested ibis): 104008512 Help Entry 104008512         CDS       T05756                                  Name (RefSeq) histone H3.3-like   KO K11253   histone H3 Organism nni  Nipponia nippon (crested ibis) Brite KEGG Orthology (KO) [BR:nni00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:nni03036]     104008512   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:nni04147]     104008512 Chromosome and associated proteins [BR:nni03036]  Eukaryotic type   Nucleosome assembly factors    Histones     104008512 Exosome [BR:nni04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    104008512 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone YebU_pre-PUA_dom PAF Motif Other DBs NCBI-GeneID:  104008512 NCBI-ProteinID:  XP_009473382 LinkDB All DBs Position Unknown AA seq 100 aa AA seqDB search GKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVR EIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAI NT seq 300 nt NT seq  +upstreamnt  +downstreamnt gggaaggcgccgaggaagcagctggccaccaaggccgccaggaagagcgcgccgtccacg gggggcgtgaagaagccccatcgctacaggcccggcacggtggccctgcgggagatccgg cgataccagaaatccacggaactgctgatccgcaagctgcccttccagcgcttggtaagg gagatcgcgcaggacttcaagaccgacctgcgcttccagagcgctgccatcggggctctg caggaagccagcgaagcgtacctcgtgggcctcttcgaggacaccaacctctgcgccatc

DBGET integrated database retrieval system