Nipponia nippon (crested ibis): 104010412 Help Entry 104010412         CDS       T05756                                  Name (RefSeq) insulin   KO K04526   insulin Organism nni  Nipponia nippon (crested ibis) Pathway nni04010   MAPK signaling pathway nni04068   FoxO signaling pathway nni04081   Hormone signaling nni04114   Oocyte meiosis nni04140   Autophagy - animal nni04150   mTOR signaling pathway nni04810   Regulation of actin cytoskeleton nni04910   Insulin signaling pathway nni04914   Progesterone-mediated oocyte maturation Brite KEGG Orthology (KO) [BR:nni00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     104010412    04068 FoxO signaling pathway     104010412    04150 mTOR signaling pathway     104010412   09133 Signaling molecules and interaction    04081 Hormone signaling     104010412  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     104010412   09143 Cell growth and death    04114 Oocyte meiosis     104010412   09142 Cell motility    04810 Regulation of actin cytoskeleton     104010412  09150 Organismal Systems   09152 Endocrine system    04910 Insulin signaling pathway     104010412    04914 Progesterone-mediated oocyte maturation     104010412  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:nni04052]     104010412 Cytokines and neuropeptides [BR:nni04052]  Neuropeptides   Unclassified    104010412 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Insulin Ins_beta Motif Other DBs NCBI-GeneID:  104010412 NCBI-ProteinID:  XP_009460806 UniProt:  A0A091UM90 LinkDB All DBs Position Unknown AA seq 107 aa AA seqDB search MALWIRSLPLLALLALSGPGTSHAAATQHLCGSHLVEALYLVCGERGFFYSPKARRDIEQ PLVSGPLHGEVGELPFQQEEFEKVKRGIVEQCCHNTCSLYQLENYCN NT seq 324 nt NT seq  +upstreamnt  +downstreamnt atggctctctggatccgatcgctgcctctcctggcccttcttgctctttccggccctggg accagccatgcggctgccacccagcacctctgtggctcccacttggtggaggctctctac ctggtgtgtggagagcggggtttcttctactcccctaaagcccgacgggacattgagcag cctctagtgagcggtcccttgcatggcgaggtaggagagctgcccttccagcaggaggag tttgagaaagtgaagcgagggatcgttgagcaatgctgccacaacacgtgctccctctac caactggaaaactactgcaactag

DBGET integrated database retrieval system