Nipponia nippon (crested ibis): 104011541 Help Entry 104011541         CDS       T05756                                  Name (RefSeq) profilin-1-like   KO K05759   profilin Organism nni  Nipponia nippon (crested ibis) Pathway nni04810   Regulation of actin cytoskeleton nni05132   Salmonella infection Brite KEGG Orthology (KO) [BR:nni00001]  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     104011541  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     104011541  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:nni04131]     104011541   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:nni04812]     104011541    04147 Exosome [BR:nni04147]     104011541 Membrane trafficking [BR:nni04131]  Others   Actin-binding proteins    Others     104011541 Cytoskeleton proteins [BR:nni04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      104011541 Exosome [BR:nni04147]  Exosomal proteins   Proteins found in most exosomes    104011541 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  104011541 NCBI-ProteinID:  XP_009462079 LinkDB All DBs Position Unknown AA seq 70 aa AA seqDB search MGYEPVSPLYPFVGGERCCFFFFSFNSVHFCFVSLCTPALVIVMGKEGVHGGTLNKKAYE LALYLRRSDV NT seq 213 nt NT seq  +upstreamnt  +downstreamnt atggggtatgaacctgtgtctcctttgtatccctttgttggtggggaaaggtgttgtttt ttttttttttcctttaattctgttcatttctgttttgtttccttgtgtactccagcattg gttatagtcatgggaaaggaaggtgtccatggagggacactcaacaagaaagcatatgaa ctggctttatacctgaggaggtctgacgtctaa

DBGET integrated database retrieval system