Nipponia nippon (crested ibis): 104011727 Help Entry 104011727         CDS       T05756                                  Name (RefSeq) histone H2A type 2-C-like   KO K11251   histone H2A Organism nni  Nipponia nippon (crested ibis) Pathway nni03082   ATP-dependent chromatin remodeling nni04217   Necroptosis Brite KEGG Orthology (KO) [BR:nni00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     104011727  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     104011727  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:nni03036]     104011727   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:nni04147]     104011727 Chromosome and associated proteins [BR:nni03036]  Eukaryotic type   Nucleosome assembly factors    Histones     104011727 Exosome [BR:nni04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    104011727 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone_H2A_C Histone Motif Other DBs NCBI-GeneID:  104011727 NCBI-ProteinID:  XP_009462293 LinkDB All DBs Position Unknown AA seq 102 aa AA seqDB search MIASFSCPTRRLLVFRVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLA IRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKKTESHKAKSK NT seq 309 nt NT seq  +upstreamnt  +downstreamnt atgatcgcttccttctcgtgtccgacgcggaggctgttggtttttcgggtgggcgccggc gccccggtgtacctggcggccgtgctggagtacctgacggccgagatcctggagctggcg ggcaacgcggcccgcgacaacaagaagacgcgcatcatcccccgccacctgcagctggcc atccgcaacgacgaggagctcaacaagctgctgggcaaggtgacgatcgcgcagggcggg gtgctgcccaacatccaggccgtgctgctgcccaagaagactgagagtcataaggctaaa agcaaatga

DBGET integrated database retrieval system