Nipponia nippon (crested ibis): 104017430 Help Entry 104017430         CDS       T05756                                  Symbol TMEM208 Name (RefSeq) transmembrane protein 208   KO K27164   SRP-independent targeting protein 2 Organism nni  Nipponia nippon (crested ibis) Pathway nni03060   Protein export Brite KEGG Orthology (KO) [BR:nni00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     104017430 (TMEM208)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:nni02000]     104017430 (TMEM208) Transporters [BR:nni02000]  Other transporters   Others    104017430 (TMEM208) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  TMEM208_SND2 Motif Other DBs NCBI-GeneID:  104017430 NCBI-ProteinID:  XP_009468732 LinkDB All DBs Position Unknown AA seq 103 aa AA seqDB search MNSMAKPSFTDDGSLADGGIDLNMEQGMAEHLKDVILLTAMVQVLSCFSLYVWYFWLLAP GRALYLLWVNILGPWFTADSSPAGQEPNEKKQRRQERRQMKRF NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atgaactccatggcaaagccatctttcacagatgatggcagcctcgccgacgggggaatt gacctgaatatggagcaggggatggcagagcacctcaaggatgtgatcctgctgacagct atggtccaagtgttgagctgcttctcgctctacgtctggtacttctggctcttggctcct ggacgtgctctctacctcctgtgggtgaacatcctggggccctggtttacagctgactct tcgcccgccggtcaggaaccaaatgagaagaagcaacgccgacaagaacgccgccagatg aagcgcttctag

DBGET integrated database retrieval system