Nipponia nippon (crested ibis): 4108700 Help Entry 4108700           CDS       T05756                                  Symbol ND3, KEG31_p06 Name (RefSeq) NADH dehydrogenase subunit 3   KO K03880   NADH-ubiquinone oxidoreductase chain 3 [EC:7.1.1.2] Organism nni  Nipponia nippon (crested ibis) Pathway nni00190   Oxidative phosphorylation nni01100   Metabolic pathways Module nni_M00142   NADH:ubiquinone oxidoreductase, mitochondria Brite KEGG Orthology (KO) [BR:nni00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     4108700 (ND3)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03029 Mitochondrial biogenesis [BR:nni03029]     4108700 (ND3) Enzymes [BR:nni01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.2  NADH:ubiquinone reductase (H+-translocating)      4108700 (ND3) Mitochondrial biogenesis [BR:nni03029]  Mitochondrial DNA transcription, translation, and replication factors   Mitochondrial DNA-encoded proteins    Mitochondrial respiratory chain complex I     4108700 (ND3) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Oxidored_q4 Claudin_3 Motif Other DBs NCBI-GeneID:  4108700 NCBI-ProteinID:  YP_637004 UniProt:  Q2PHI6 LinkDB All DBs Position MT AA seq 116 aa AA seqDB search MNMITFMLTLSFTLTIILITLNFWLAQTNPDSEKLSPYECGFDPLGSARLPFSIRFFLVA ILFLLFDLEIALLLPLPWAIQLQSPTTTLTWASIIIILLTVGLIYEWIQGGLEWAE NT seq 351 nt NT seq  +upstreamnt  +downstreamnt atcaacataatcacatttatacttacactatccttcacccttaccatcatcctaatcaca ctaaacttctgacttgctcaaaccaacccagactcggaaaaactctccccatacgaatgc ggcttcgaccccctcgggtctgcccgactcccattctcaattcgcttcttcctagtagca atcctattcttactattcgacctagagatcgcacttctactcccacttccctgagctatc caacttcaatcgcccaccaccacccttacctgagcctctatcatcatcattctactcaca gtaggactaatctatgagtgaattcaagggggcctagaatgagcagaatag

DBGET integrated database retrieval system