Nestor notabilis (Kea): 104400344 Help Entry 104400344         CDS       T08494                                  Name (RefSeq) ras-related protein Rab-8A   KO K07901   Ras-related protein Rab-8A Organism nnt  Nestor notabilis (Kea) Pathway nnt04140   Autophagy - animal nnt04144   Endocytosis nnt04530   Tight junction Brite KEGG Orthology (KO) [BR:nnt00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     104400344    04140 Autophagy - animal     104400344   09144 Cellular community - eukaryotes    04530 Tight junction     104400344  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:nnt04131]     104400344    03036 Chromosome and associated proteins [BR:nnt03036]     104400344   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:nnt04147]     104400344    04031 GTP-binding proteins [BR:nnt04031]     104400344 Membrane trafficking [BR:nnt04131]  Exocytosis   Small GTPases and associated proteins    Rab GTPases     104400344  Autophagy   Other autophagy associated proteins     104400344 Chromosome and associated proteins [BR:nnt03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     104400344 Exosome [BR:nnt04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    104400344   Exosomal proteins of other body fluids (saliva and urine)    104400344   Exosomal proteins of colorectal cancer cells    104400344 GTP-binding proteins [BR:nnt04031]  Small (monomeric) G-proteins   Rab Family    Rab8/10/13 [OT]     104400344 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc DUF3963 Motif Other DBs NCBI-GeneID:  104400344 NCBI-ProteinID:  XP_010019859 LinkDB All DBs Position Unknown AA seq 125 aa AA seqDB search GIMLVYDITNEKSFENIRNWVRNIEEHASPDVEKMILGNKCDANDKRQVSREQGEKLAAS FGIKFMETSAKANINIENAFFTLARDIKAKMDKKLEGNSPQGSNQGVKITPEQQKKSSFF RCVLL NT seq 378 nt NT seq  +upstreamnt  +downstreamnt ggcattatgttagtctacgacatcaccaatgagaaatcgttcgagaacattcggaactgg gtcaggaatatcgaagagcacgcctctccggatgtcgagaagatgatcttgggaaacaaa tgcgatgcaaatgacaaaagacaagtgtccagagagcaaggggagaagctcgctgccagc ttcggaattaagttcatggagaccagcgcaaaggcaaatataaacatagagaacgcattt ttcactctggcaagagatatcaaagcaaaaatggacaagaagttggaaggcaacagcccc cagggcagcaaccagggcgtcaaaatcacaccggagcagcagaagaaaagcagctttttc cgatgcgttcttctgtga

DBGET integrated database retrieval system