Nestor notabilis (Kea): 104401663 Help Entry 104401663         CDS       T08494                                  Symbol NRAS Name (RefSeq) GTPase NRas   KO K07828   GTPase NRas Organism nnt  Nestor notabilis (Kea) Pathway nnt04010   MAPK signaling pathway nnt04012   ErbB signaling pathway nnt04068   FoxO signaling pathway nnt04137   Mitophagy - animal nnt04140   Autophagy - animal nnt04150   mTOR signaling pathway nnt04210   Apoptosis nnt04218   Cellular senescence nnt04370   VEGF signaling pathway nnt04371   Apelin signaling pathway nnt04519   Cadherin signaling nnt04540   Gap junction nnt04625   C-type lectin receptor signaling pathway nnt04810   Regulation of actin cytoskeleton nnt04910   Insulin signaling pathway nnt04912   GnRH signaling pathway nnt04916   Melanogenesis Brite KEGG Orthology (KO) [BR:nnt00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     104401663 (NRAS)    04012 ErbB signaling pathway     104401663 (NRAS)    04370 VEGF signaling pathway     104401663 (NRAS)    04371 Apelin signaling pathway     104401663 (NRAS)    04068 FoxO signaling pathway     104401663 (NRAS)    04150 mTOR signaling pathway     104401663 (NRAS)   09133 Signaling molecules and interaction    04519 Cadherin signaling     104401663 (NRAS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     104401663 (NRAS)    04137 Mitophagy - animal     104401663 (NRAS)   09143 Cell growth and death    04210 Apoptosis     104401663 (NRAS)    04218 Cellular senescence     104401663 (NRAS)   09144 Cellular community - eukaryotes    04540 Gap junction     104401663 (NRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     104401663 (NRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     104401663 (NRAS)   09152 Endocrine system    04910 Insulin signaling pathway     104401663 (NRAS)    04912 GnRH signaling pathway     104401663 (NRAS)    04916 Melanogenesis     104401663 (NRAS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:nnt04131]     104401663 (NRAS)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:nnt04147]     104401663 (NRAS)    04031 GTP-binding proteins [BR:nnt04031]     104401663 (NRAS) Membrane trafficking [BR:nnt04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     104401663 (NRAS)  Endocytosis   Macropinocytosis    Ras GTPases     104401663 (NRAS) Exosome [BR:nnt04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    104401663 (NRAS)   Exosomal proteins of other body fluids (saliva and urine)    104401663 (NRAS)   Exosomal proteins of breast cancer cells    104401663 (NRAS)   Exosomal proteins of colorectal cancer cells    104401663 (NRAS) GTP-binding proteins [BR:nnt04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     104401663 (NRAS) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc GTP_EFTU Arf FeoB_N RsgA_GTPase MMR_HSR1 IL23 Motif Other DBs NCBI-GeneID:  104401663 NCBI-ProteinID:  XP_010007628 LinkDB All DBs Position Unknown AA seq 152 aa AA seqDB search DSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYR EQIKRVKDSDDVPMVLVGNKCDLPTRTVDTKQAQELAKSYGIPFIETSAKTRQGVEDAFY TLVREIRQYRMKKLNSNEDGNQGCMGLSCIVM NT seq 459 nt NT seq  +upstreamnt  +downstreamnt gactcatacagaaagcaggtggttatcgatggcgagacgtgcctgttggacatcctggac actgcggggcaggaggagtacagcgccatgcgggaccagtacatgcgaactggggaagga ttcctctgcgtctttgccattaacaacagtaaatcatttgctgatattaacctttacaga gagcagatcaagagagtgaaagattcggatgatgtgccaatggtgctagttgggaacaag tgtgatttgcccacgagaacagtagacacaaaacaggctcaagaattagcaaaaagctat ggaatccccttcatagagacgtctgctaaaacaagacagggcgtggaagatgctttttat acactggtgagagagatccggcagtaccggatgaaaaagctcaacagcaacgaagatggg aatcaaggctgcatgggattgtcctgcattgtgatgtga

DBGET integrated database retrieval system