Nestor notabilis (Kea): 104401830 Help Entry 104401830         CDS       T08494                                  Symbol RHOA Name (RefSeq) transforming protein RhoA   KO K04513   Ras homolog gene family, member A Organism nnt  Nestor notabilis (Kea) Pathway nnt04081   Hormone signaling nnt04144   Endocytosis nnt04150   mTOR signaling pathway nnt04270   Vascular smooth muscle contraction nnt04310   Wnt signaling pathway nnt04350   TGF-beta signaling pathway nnt04510   Focal adhesion nnt04520   Adherens junction nnt04530   Tight junction nnt04621   NOD-like receptor signaling pathway nnt04625   C-type lectin receptor signaling pathway nnt04810   Regulation of actin cytoskeleton nnt05100   Bacterial invasion of epithelial cells nnt05132   Salmonella infection Brite KEGG Orthology (KO) [BR:nnt00001]  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     104401830 (RHOA)    04350 TGF-beta signaling pathway     104401830 (RHOA)    04150 mTOR signaling pathway     104401830 (RHOA)   09133 Signaling molecules and interaction    04081 Hormone signaling     104401830 (RHOA)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     104401830 (RHOA)   09144 Cellular community - eukaryotes    04510 Focal adhesion     104401830 (RHOA)    04520 Adherens junction     104401830 (RHOA)    04530 Tight junction     104401830 (RHOA)   09142 Cell motility    04810 Regulation of actin cytoskeleton     104401830 (RHOA)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     104401830 (RHOA)    04625 C-type lectin receptor signaling pathway     104401830 (RHOA)   09153 Circulatory system    04270 Vascular smooth muscle contraction     104401830 (RHOA)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     104401830 (RHOA)    05100 Bacterial invasion of epithelial cells     104401830 (RHOA)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:nnt04131]     104401830 (RHOA)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:nnt04147]     104401830 (RHOA)    04031 GTP-binding proteins [BR:nnt04031]     104401830 (RHOA) Membrane trafficking [BR:nnt04131]  Endocytosis   Lipid raft mediated endocytosis    RhoA-dependent endocytosis     104401830 (RHOA) Exosome [BR:nnt04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    104401830 (RHOA)   Exosomal proteins of other body fluids (saliva and urine)    104401830 (RHOA)   Exosomal proteins of colorectal cancer cells    104401830 (RHOA)   Exosomal proteins of bladder cancer cells    104401830 (RHOA) GTP-binding proteins [BR:nnt04031]  Small (monomeric) G-proteins   Rho Family    RhoA/B/C [OT]     104401830 (RHOA) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA SRPRB VASP_tetra Motif Other DBs NCBI-GeneID:  104401830 NCBI-ProteinID:  XP_010007834 LinkDB All DBs Position Unknown AA seq 193 aa AA seqDB search MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDT AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD LRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQ ARRGKKKSGCLLL NT seq 582 nt NT seq  +upstreamnt  +downstreamnt atggcagccattcgaaaaaagctggttatagtgggagatggtgcctgtgggaagacctgt ctgctgattgtgtttagcaaagaccagttccctgaagtgtatgttcccaccgtctttgaa aattacgtagcagatatcgaagtggatggaaagcaggttgagttggctttgtgggataca gcaggacaagaagactatgatcgacttagaccgctttcttatccagatactgatgttata cttatgtgtttttcaattgatagtcctgatagtttagaaaacatcccggagaagtggacc ccagaggtgaagcatttctgccccaacgtgcctatcatcttggtaggaaacaagaaggac ctgaggaatgacgagcacacaagacgagagctggccaaaatgaagcaggagcctgtcaaa ccagaagaaggaagagatatggcaaaccgcattggtgcttttgggtatatggagtgttcg gcaaagaccaaagacggtgtgagggaggtttttgaaatggccactagagctgctttgcaa gcccggcgtggcaagaaaaagtccgggtgccttctcttataa

DBGET integrated database retrieval system