Nestor notabilis (Kea): 104404955 Help Entry 104404955         CDS       T08494                                  Symbol INS Name (RefSeq) insulin   KO K04526   insulin Organism nnt  Nestor notabilis (Kea) Pathway nnt04010   MAPK signaling pathway nnt04068   FoxO signaling pathway nnt04081   Hormone signaling nnt04114   Oocyte meiosis nnt04140   Autophagy - animal nnt04150   mTOR signaling pathway nnt04810   Regulation of actin cytoskeleton nnt04910   Insulin signaling pathway nnt04914   Progesterone-mediated oocyte maturation Brite KEGG Orthology (KO) [BR:nnt00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     104404955 (INS)    04068 FoxO signaling pathway     104404955 (INS)    04150 mTOR signaling pathway     104404955 (INS)   09133 Signaling molecules and interaction    04081 Hormone signaling     104404955 (INS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     104404955 (INS)   09143 Cell growth and death    04114 Oocyte meiosis     104404955 (INS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     104404955 (INS)  09150 Organismal Systems   09152 Endocrine system    04910 Insulin signaling pathway     104404955 (INS)    04914 Progesterone-mediated oocyte maturation     104404955 (INS)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:nnt04052]     104404955 (INS) Cytokines and neuropeptides [BR:nnt04052]  Neuropeptides   Unclassified    104404955 (INS) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Insulin Ins_beta Motif Other DBs NCBI-GeneID:  104404955 NCBI-ProteinID:  XP_010011817 UniProt:  A0A091S0U5 LinkDB All DBs Position Unknown AA seq 107 aa AA seqDB search MALWILSLPLLALLALSGPGTSHAAANQHLCGSHLVEALYLVCGERGFFYSPKARRDVEQ PLVSGPLHGEVGDLPFQPEEFQKVKRGIVEQCCHNTCSLYQLENYCN NT seq 324 nt NT seq  +upstreamnt  +downstreamnt atggctctctggatcctatcactgcctctcctggcccttcttgctctttctggcccaggg accagccatgcagctgccaaccagcacctctgcggctcacacttggtggaggctctctac ctggtgtgtggagagcggggtttcttctactcccccaaagcccgacgggatgttgaacag cctctagtgagcggtcctttgcacggtgaggtaggagacctgcccttccagccagaggag tttcagaaagtgaagcgagggattgttgagcaatgctgccacaacacctgctccctgtac caactggaaaactactgcaactag

DBGET integrated database retrieval system