Nestor notabilis (Kea): 104407496 Help Entry 104407496         CDS       T08494                                  Name (RefSeq) interleukin-8-like   KO K10030   interleukin 8 Organism nnt  Nestor notabilis (Kea) Pathway nnt04060   Cytokine-cytokine receptor interaction nnt04218   Cellular senescence nnt04620   Toll-like receptor signaling pathway nnt04621   NOD-like receptor signaling pathway nnt04622   RIG-I-like receptor signaling pathway nnt05132   Salmonella infection nnt05164   Influenza A Brite KEGG Orthology (KO) [BR:nnt00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     104407496  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     104407496  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     104407496    04621 NOD-like receptor signaling pathway     104407496    04622 RIG-I-like receptor signaling pathway     104407496  09160 Human Diseases   09172 Infectious disease: viral    05164 Influenza A     104407496   09171 Infectious disease: bacterial    05132 Salmonella infection     104407496  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:nnt04052]     104407496    00536 Glycosaminoglycan binding proteins [BR:nnt00536]     104407496 Cytokines and neuropeptides [BR:nnt04052]  Cytokines   Chemokines    104407496 Glycosaminoglycan binding proteins [BR:nnt00536]  Heparan sulfate / Heparin   Chemokines    104407496 SSDB OrthologParalogGFIT Motif Pfam:  IL8 Ig_J_chain Motif Other DBs NCBI-GeneID:  104407496 NCBI-ProteinID:  XP_010015100 LinkDB All DBs Position Unknown AA seq 103 aa AA seqDB search MNGKLMAVLTLCLISMAVSQGRTLARMGTELRCQCIATHSKFIPPKSIQDVKLTQSGPHC KNVEVIATLKDGREVCLEPTAPWVQIIVKAILAKAQLNSDSPV NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atgaacggcaaactcatggctgtcctgactctgtgcctgatctccatggctgtgtctcag ggtaggaccctggccaggatgggaactgagctccggtgccagtgcatagccactcattcc aagttcatccctcctaagtccattcaagatgtgaagctgacacagagcggcccccactgc aagaatgttgaagtcatagctactctgaaggatggcagagaggtgtgcttggagcccact gctccctgggtacagataatcgtaaaggcaattttggccaaggctcaactcaactctgac tcgccagtctaa

DBGET integrated database retrieval system