Nestor notabilis (Kea): 104407921 Help Entry 104407921         CDS       T08494                                  Symbol DYNLT3 Name (RefSeq) dynein light chain Tctex-type 3   KO K10420   dynein light chain Tctex-type 1/3 Organism nnt  Nestor notabilis (Kea) Pathway nnt04814   Motor proteins nnt05132   Salmonella infection Brite KEGG Orthology (KO) [BR:nnt00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     104407921 (DYNLT3)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     104407921 (DYNLT3)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:nnt03037]     104407921 (DYNLT3)    04812 Cytoskeleton proteins [BR:nnt04812]     104407921 (DYNLT3) Cilium and associated proteins [BR:nnt03037]  Motile cilia and associated proteins   Dynein arm    104407921 (DYNLT3) Cytoskeleton proteins [BR:nnt04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      104407921 (DYNLT3) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Tctex-1 Motif Other DBs NCBI-GeneID:  104407921 NCBI-ProteinID:  XP_010015637 LinkDB All DBs Position Unknown AA seq 106 aa AA seqDB search MIFNADEAHNIVKECIESVLGKADYNHNKVNQWTAAIVEQSLTHLVKLGKTYKYIVTCAV MQRSGAGLHTASSCFWDTTTDGTCTVRWENRTMNCIVNVFAVAIIL NT seq 321 nt NT seq  +upstreamnt  +downstreamnt atgatcttcaatgctgatgaggcccacaacatagttaaggagtgcatagaaagtgttcta ggcaaggcagattataatcacaacaaagtcaaccagtggactgctgctatagtagaacag tcgctgacacatctggtaaaacttggaaaaacgtataagtacattgtaacatgtgcagtg atgcagaggagtggagctggtcttcacacagcaagctcatgcttctgggatactacaact gatggaacctgcacagtgagatgggaaaaccgaacaatgaactgcattgtcaatgtgttt gctgttgctattatcctgtag

DBGET integrated database retrieval system