Nestor notabilis (Kea): 104412171 Help Entry 104412171         CDS       T08494                                  Name (RefSeq) metallothionein-2   KO K14739   metallothionein 1/2 Organism nnt  Nestor notabilis (Kea) Brite KEGG Orthology (KO) [BR:nnt00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:nnt03019]     104412171    03029 Mitochondrial biogenesis [BR:nnt03029]     104412171 Messenger RNA biogenesis [BR:nnt03019]  Eukaryotic type   mRNA surveillance and transport factors    Factors involved in mRNA localization     Factors that have mRNA localization signals      104412171 Mitochondrial biogenesis [BR:nnt03029]  Mitochondrial quality control factors   Regulator of mitochondrial biogenesis    Nuclear respiratory factors     104412171 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Metallothio Motif Other DBs NCBI-GeneID:  104412171 NCBI-ProteinID:  XP_010021097 LinkDB All DBs Position Unknown AA seq 63 aa AA seqDB search MDPQDCTCAAGDSCSCAGSCKCKNCRCRSCRKSCCSCCPASCSNCAKGCVCKEPASSKCS CCH NT seq 192 nt NT seq  +upstreamnt  +downstreamnt atggatccccaggactgcacgtgtgccgccggtgactcctgctcctgcgccgggtcctgc aagtgcaagaactgccgctgccgcagctgccgcaagagctgctgctcctgctgccccgca agctgcagcaactgtgccaagggctgtgtgtgcaaggagccggccagcagcaagtgcagc tgctgccactga

DBGET integrated database retrieval system