Nelumbo nucifera (sacred lotus): 104592753 Help Entry 104592753         CDS       T04131                                  Name (RefSeq) centromere protein S   KO K11511   centromere protein S Organism nnu  Nelumbo nucifera (sacred lotus) Pathway nnu03460   Fanconi anemia pathway Brite KEGG Orthology (KO) [BR:nnu00001]  09120 Genetic Information Processing   09124 Replication and repair    03460 Fanconi anemia pathway     104592753  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:nnu03036]     104592753    03400 DNA repair and recombination proteins [BR:nnu03400]     104592753 Chromosome and associated proteins [BR:nnu03036]  Eukaryotic type   Centromeric chromatin formation proteins    Kinetochore proteins     Centromere proteins      104592753 DNA repair and recombination proteins [BR:nnu03400]  Eukaryotic type   DSBR (double strand breaks repair)    FA (Fanconi anemia) pathway     FA core complex binding factors      104592753 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  CENP-S CENP-T_C Bromo_TP TFIID-31kDa YqzE Motif Other DBs NCBI-GeneID:  104592753 NCBI-ProteinID:  XP_010250526 UniProt:  A0A1U7ZPD4 LinkDB All DBs Position Un AA seq 132 aa AA seqDB search MEEGESNFGREEDEAETELLRDRFRLFAVSIAEAEAKRNEMEISQPVMECIADLAFKFSE QLAKDLELFAHHAGRKSANMEDVILSAHRNENLATSLRSFCNDLKGKEPQSERKRKKALK KEKTTPSAFHIS NT seq 399 nt NT seq  +upstreamnt  +downstreamnt atggaagaaggggaaagcaatttcgggagagaagaagacgaagcagaaacagagctcttg agggatcggttccgactcttcgctgtttcaattgcggaggctgaagccaaaagaaatgaa atggagatatcccagccagtcatggagtgcatagccgacctcgcctttaaattttcagag cagttggcaaaagacttggaactatttgcacatcatgcgggccgcaagtctgcaaacatg gaagatgtcatactttctgcacataggaatgagaacctggctacctcattgagatccttt tgcaatgacctgaagggcaaagaaccccaaagtgagaggaagcggaagaaagctctaaaa aaagaaaagactacacccagcgcttttcacatttcttga

DBGET integrated database retrieval system