Nelumbo nucifera (sacred lotus): 104603641 Help Entry 104603641         CDS       T04131                                  Name (RefSeq) SKP1-like protein 1B   KO K03094   S-phase kinase-associated protein 1 Organism nnu  Nelumbo nucifera (sacred lotus) Pathway nnu03083   Polycomb repressive complex nnu04120   Ubiquitin mediated proteolysis nnu04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:nnu00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     104603641    04120 Ubiquitin mediated proteolysis     104603641   09126 Chromosome    03083 Polycomb repressive complex     104603641  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:nnu04131]     104603641    04121 Ubiquitin system [BR:nnu04121]     104603641    03036 Chromosome and associated proteins [BR:nnu03036]     104603641 Membrane trafficking [BR:nnu04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     104603641 Ubiquitin system [BR:nnu04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      104603641    Cul7 complex      104603641 Chromosome and associated proteins [BR:nnu03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      104603641   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      104603641 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Skp1 Skp1_POZ Methyltransf_16 Motif Other DBs NCBI-GeneID:  104603641 NCBI-ProteinID:  XP_010266012 UniProt:  A0A1U8AT37 LinkDB All DBs Position Un AA seq 154 aa AA seqDB search MSGKKVTLKSSDGETFDVDEAVALESQTIKHMIEDDCADNGIPLPNVTSKILSKVIEYCK KHVETPKTDDRGAEDELKNWDAEFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADMIK GKTPEEIRKTFNIKNDFTPEEEEEVRRENQWAFE NT seq 465 nt NT seq  +upstreamnt  +downstreamnt atgtcggggaagaaggttaccttgaagagctccgatggagagaccttcgatgttgatgaa gccgttgcccttgaatcccagaccatcaagcacatgatcgaggacgattgtgctgataac gggatccccttgcccaacgtcaccagtaagatcttgtccaaggttattgagtactgtaag aagcacgtcgagactcctaagaccgacgatcgtggtgctgaggatgagttgaagaactgg gacgccgagtttgtcaaggtcgaccaggccacacttttcgatctcatattggcagctaac tacttgaacataaaaagcttgctggatcttacttgccaaacggtggcggacatgatcaag ggtaaaactccggaggagataagaaagacattcaacatcaagaatgacttcacccccgag gaggaagaggaagtgaggagggagaatcagtgggctttcgagtga

DBGET integrated database retrieval system