Nelumbo nucifera (sacred lotus): 104607922 Help Entry 104607922         CDS       T04131                                  Name (RefSeq) rac-like GTP-binding protein 3   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism nnu  Nelumbo nucifera (sacred lotus) Pathway nnu04145   Phagosome nnu04148   Efferocytosis nnu04620   Toll-like receptor signaling pathway nnu05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:nnu00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     104607922    04148 Efferocytosis     104607922  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     104607922  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     104607922  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:nnu04131]     104607922   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:nnu04147]     104607922    04031 GTP-binding proteins [BR:nnu04031]     104607922 Membrane trafficking [BR:nnu04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     104607922  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     104607922   Macropinocytosis    Ras GTPases     104607922  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     104607922 Exosome [BR:nnu04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    104607922   Exosomal proteins of other body fluids (saliva and urine)    104607922   Exosomal proteins of colorectal cancer cells    104607922   Exosomal proteins of bladder cancer cells    104607922 GTP-binding proteins [BR:nnu04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     104607922 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  104607922 NCBI-ProteinID:  XP_010272004 UniProt:  A0A1U8AV46 LinkDB All DBs Position Un AA seq 211 aa AA seqDB search MASTASRFIKCVTVGDGAVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVVEGTTVNLGL WDTAGQEDYNRLRPLSYRGADVFVLAFSLVSRASYENVLKKWIPELQHYAPGVPVVLAGT KLDLREDKHYLADHPGMVPVTTAQGEELQKQIGAAYYIECSSKTQQNVKAVFDAAIKVVI KPPQKQKEKKKPRQGCSLWNVFRGSKFTCFN NT seq 636 nt NT seq  +upstreamnt  +downstreamnt atggcctcaaccgcttcaagattcatcaaatgtgttacagtcggagatggggctgttggg aagacttgcatgctcatctgctacacaagtaacaaattccccactgactatataccaaca gtttttgataacttcagcgccaatgtagttgtcgaaggaactactgtcaatttaggcctc tgggacactgctggacaagaggattacaatagattaaggcccttgagctacagaggagcg gatgtgttcgtcttagctttctcgcttgttagccgtgcaagctatgagaatgtactgaaa aagtggatcccagaacttcagcattatgctcccggagtccctgttgttcttgctggcact aaattggatcttcgtgaagataagcactatttagctgatcatcctggaatggtgcctgta actactgcacagggagaggaactccagaaacagattggtgctgcatattatattgaatgc agctcaaaaactcagcagaatgtcaaagcagtttttgatgcagcaatcaaggtagtaatc aagccaccacagaaacagaaggagaagaaaaaaccacgccaaggatgttctctatggaat gtctttcgtggcagtaaattcacttgcttcaattga

DBGET integrated database retrieval system