Actinomadura parvosata subsp. kistnae: BKM31_54155 Help Entry BKM31_54155       CDS       T04759                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism noa  Actinomadura parvosata subsp. kistnae Pathway noa00261   Monobactam biosynthesis noa01100   Metabolic pathways noa01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:noa00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     BKM31_54155  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:noa01008]     BKM31_54155 Polyketide biosynthesis proteins [BR:noa01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     BKM31_54155 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AQZ69230 UniProt:  A0A1V0AG99 LinkDB All DBs Position 12014882..12015112 Genome browser AA seq 76 aa AA seqDB search MTNPFDDVDGTFFVLVNDEGQHSLWPVFAEIPQGWTAVYGEAGRQECLQYVEEHWTDMRP KSLVAQMDGRSPDARA NT seq 231 nt NT seq  +upstreamnt  +downstreamnt gtgacgaacccgttcgatgacgtggacggcaccttcttcgtgctggtcaacgacgagggg cagcactccctgtggcccgtcttcgccgagatcccccaggggtggacggcggtgtacggc gaggccggcaggcaggagtgcctgcagtacgtcgaggagcactggaccgacatgcggccc aagagcctcgtcgcgcagatggacgggcgttcgccggacgcccgggcctga

DBGET integrated database retrieval system