Nitrosococcus oceani: Noc_1963 Help Entry Noc_1963          CDS       T00281                                  Name (GenBank) hypothetical protein   KO K02078   acyl carrier protein Organism noc  Nitrosococcus oceani Pathway noc00998   Biosynthesis of various antibiotics noc01100   Metabolic pathways noc01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:noc00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Noc_1963    00074 Mycolic acid biosynthesis     Noc_1963   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Noc_1963 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  ABA58425 UniProt:  Q3J9S1 LinkDB All DBs Position complement(2249678..2249968) Genome browser AA seq 96 aa AA seqDB search MNENVVRNANTVNVHTVGETILIVSEVLQLSDRTRQAMTAETCLLGAVPEFDSMAVVSII TALEEQYGFIVDDDEVEASTFETVGSLADFVNKKLS NT seq 291 nt NT seq  +upstreamnt  +downstreamnt atgaatgaaaatgtagtaaggaacgcaaatactgtcaatgttcatactgtcggtgaaact attctcatcgttagtgaggtgttgcagctcagtgatcggacccgccaggccatgacagct gagacgtgcctgctaggtgctgtgccagagttcgattctatggcggtagtttctattatt actgctctagaagagcagtacggttttatagtggatgatgatgaggtggaggcatccacc tttgagacggtgggaagccttgcggattttgtgaataaaaagctttcgtga

DBGET integrated database retrieval system