Nocardioides sp. JQ2195: ncot_12400 Help Entry ncot_12400        CDS       T10874                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism noca  Nocardioides sp. JQ2195 Pathway noca01100   Metabolic pathways noca01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:noca00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     ncot_12400    00074 Mycolic acid biosynthesis     ncot_12400   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     ncot_12400 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Ribosomal_L50 PP-binding_2 DUF7080 HD-ZIP_N Motif Other DBs NCBI-ProteinID:  QIX27312 UniProt:  A0A6H1A2M2 LinkDB All DBs Position 2633022..2633267 Genome browser AA seq 81 aa AA seqDB search MATTEEIRSDLAEIVNEVAGIPADDVQLEKSFVDDLDVDSLSMVEVVVAAEEKFGVSIPD DQVKNLKTVGDAVSFIENAAS NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atggccaccaccgaagagatccgctccgacctcgccgagatcgtcaacgaggtcgccggc atccccgccgatgacgtgcagctggagaagtcgttcgtcgacgacctcgacgtcgactcg ctgtccatggtcgaggtcgtcgtggccgccgaggagaagttcggcgtctcgatccccgac gaccaggtgaagaacctcaagaccgtcggcgacgccgtgtcgttcatcgagaacgccgcc agctga

DBGET integrated database retrieval system