Candidatus Nanohalococcus occultus: SVXNc_0794 Help Entry SVXNc_0794        CDS       T10160                                  Name (GenBank) hypothetical protein   KO K03116   sec-independent protein translocase protein TatA Organism nocc  Candidatus Nanohalococcus occultus Pathway nocc03060   Protein export nocc03070   Bacterial secretion system Brite KEGG Orthology (KO) [BR:nocc00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     SVXNc_0794  09130 Environmental Information Processing   09131 Membrane transport    03070 Bacterial secretion system     SVXNc_0794  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:nocc02044]     SVXNc_0794 Secretion system [BR:nocc02044]  Twin-arginine translocation (Tat) system   Twin-arginine translocation (Tat) pathway protein    SVXNc_0794 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  TatA_B_E RecJ_C_Deinoc Motif Other DBs NCBI-ProteinID:  WEL19801 LinkDB All DBs Position complement(686563..686715) Genome browser AA seq 50 aa AA seqDB search MAGAIVALVLGPKKLPELAGSLGESKKEFRKSMKEADEVTEALNSDEDES NT seq 153 nt NT seq  +upstreamnt  +downstreamnt gtggctggagcgatagttgctttggttttaggtccgaagaaacttccggagcttgcggga agtctcggtgagtcgaaaaaggagtttaggaaatcgatgaaggaagcggatgaggtaact gaagcgcttaactctgatgaagacgagagctga

DBGET integrated database retrieval system