Neobacillus oceani: V1499_04235 Help Entry V1499_04235       CDS       T11220                                  Name (GenBank) 4Fe-4S binding protein   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism noce  Neobacillus oceani Pathway noce00020   Citrate cycle (TCA cycle) noce00720   Other carbon fixation pathways noce01100   Metabolic pathways noce01110   Biosynthesis of secondary metabolites noce01120   Microbial metabolism in diverse environments noce01200   Carbon metabolism noce01210   2-Oxocarboxylic acid metabolism Module noce_M00009   Citrate cycle (TCA cycle, Krebs cycle) noce_M00011   Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate Brite KEGG Orthology (KO) [BR:noce00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     V1499_04235   09102 Energy metabolism    00720 Other carbon fixation pathways     V1499_04235 Enzymes [BR:noce01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      V1499_04235 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_21 Fer4_7 Fer4_10 Fer4_9 Fer4_6 Fer4_16 Fer4_2 Fer4_4 LdpA_Fe-S-bd Fer4_13 Fer4_8 Fer4_18 Fer4_17 Fer4_3 Fer4_15 Motif Other DBs NCBI-ProteinID:  XOL51953 LinkDB All DBs Position 851586..851816 Genome browser AA seq 76 aa AA seqDB search MERRVVFSEAYCKSCSLCVQVCPVSIIFLADYLNGKGYRPATVTDQEKCISCAKCGQICP DGVITVYRPEKKKQTV NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atggagcgaagagttgtttttagcgaagcgtattgtaaatcctgcagcctttgtgtacag gtttgcccggtatcaatcatcttccttgcagattatctaaatggaaaaggctatcgtccc gcaacagttacggatcaggaaaagtgtataagctgtgcgaaatgcggccagatttgcccg gatggggtcataaccgtctaccgtcctgaaaagaaaaagcaaaccgtgtag

DBGET integrated database retrieval system