Neobacillus oceani: V1499_18695
Help
Entry
V1499_18695 CDS
T11220
Name
(GenBank) metal-dependent transcriptional regulator
KO
K11924
DtxR family transcriptional regulator, manganese transport regulator
Organism
noce Neobacillus oceani
Brite
KEGG Orthology (KO) [BR:
noce00001
]
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03000 Transcription factors [BR:
noce03000
]
V1499_18695
Transcription factors [BR:
noce03000
]
Prokaryotic type
Helix-turn-helix
Other families
V1499_18695
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Fe_dep_repress
Fe_dep_repr_C
HTH_24
MarR_2
MarR
HTH_Crp_2
HTH_27
HTH_46
HTH_45
HTH_36
DUF7343
HTH_34
TrmB
Crp
wHTH-PRTase_assc
HTH_41
HTH_11
DUF6746
DUF6293_C
HTH_IclR
FeoC
Motif
Other DBs
NCBI-ProteinID:
XOL50440
LinkDB
All DBs
Position
complement(3701935..3702294)
Genome browser
AA seq
119 aa
AA seq
DB search
MNASPSEGKYLDEVYRSVEANGHARVSYLAKVLGLSVSGVSKMIGKLTKDGYIHFERYGI
ITLTEKGKIAGKELEERRLVLVSLFRKIGLEAERIDEEVHNLKYTISQNAVEKIKDFLN
NT seq
360 nt
NT seq
+upstream
nt +downstream
nt
gtgaatgcatccccaagcgaagggaaatatttggacgaagtttaccgatccgttgaggcg
aacgggcatgcaagagtatcatatcttgcgaaagtgcttggactgtccgtttcaggagta
tcgaaaatgattggaaaattaacaaaggatgggtatattcactttgaacgttacggaatc
atcacccttactgaaaaagggaaaatagcgggaaaggagttggaagaaaggcgtctggtt
ttggtttccctctttcgaaaaattggcctggaagctgaaaggattgatgaggaagtgcat
aatttaaaatatactattagccaaaatgccgtagaaaaaataaaggattttttaaactga
DBGET
integrated database retrieval system