Neobacillus oceani: V1499_21875 Help Entry V1499_21875       CDS       T11220                                  Name (GenBank) 2-hydroxymuconate tautomerase   KO K01821   4-oxalocrotonate tautomerase [EC:5.3.2.6] Organism noce  Neobacillus oceani Pathway noce00362   Benzoate degradation noce00622   Xylene degradation noce01100   Metabolic pathways noce01120   Microbial metabolism in diverse environments noce01220   Degradation of aromatic compounds Brite KEGG Orthology (KO) [BR:noce00001]  09100 Metabolism   09111 Xenobiotics biodegradation and metabolism    00362 Benzoate degradation     V1499_21875    00622 Xylene degradation     V1499_21875    00621 Dioxin degradation     V1499_21875 Enzymes [BR:noce01000]  5. Isomerases   5.3  Intramolecular oxidoreductases    5.3.2  Interconverting keto- and enol-groups     5.3.2.6  2-hydroxymuconate tautomerase      V1499_21875 SSDB OrthologParalogGFIT Motif Pfam:  Tautomerase Tautomerase_2 Tautomerase_3 Motif Other DBs NCBI-ProteinID:  XOL51038 LinkDB All DBs Position 4360708..4360893 Genome browser AA seq 61 aa AA seqDB search MPIVTVKMLEGRTDEQKKALVAKVTEAVVETAGAPKENVTVIIEEMAKNHYAKAGVRASD Q NT seq 186 nt NT seq  +upstreamnt  +downstreamnt atgccaatcgtaacagtcaaaatgcttgaaggtcgtaccgatgaacagaaaaaggcgctt gttgcaaaagtaaccgaagccgtcgttgaaactgccggcgctccgaaggaaaacgtcacc gtcatcattgaagaaatggcgaaaaaccattatgccaaagcaggcgtcagggcaagcgac caatag

DBGET integrated database retrieval system