KEGG   Nocardioides sp. QY071: QI633_04305
Entry
QI633_04305       CDS       T10893                                 
Name
(GenBank) phosphoglyceromutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
nocq  Nocardioides sp. QY071
Pathway
nocq00010  Glycolysis / Gluconeogenesis
nocq00260  Glycine, serine and threonine metabolism
nocq00680  Methane metabolism
nocq01100  Metabolic pathways
nocq01110  Biosynthesis of secondary metabolites
nocq01120  Microbial metabolism in diverse environments
nocq01200  Carbon metabolism
nocq01230  Biosynthesis of amino acids
Module
nocq_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
nocq_M00002  Glycolysis, core module involving three-carbon compounds
nocq_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:nocq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    QI633_04305
  09102 Energy metabolism
   00680 Methane metabolism
    QI633_04305
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    QI633_04305
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:nocq04131]
    QI633_04305
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:nocq04147]
    QI633_04305
Enzymes [BR:nocq01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     QI633_04305
Membrane trafficking [BR:nocq04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    QI633_04305
Exosome [BR:nocq04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   QI633_04305
  Exosomal proteins of melanoma cells
   QI633_04305
SSDB
Motif
Pfam: His_Phos_1 bpX5
Other DBs
NCBI-ProteinID: WGY02980
LinkDB
Position
complement(912285..913031)
AA seq 248 aa
MTFTLVLLRHGESEWNAKNLFTGWVDVALTEKGRGEAVRGGELLAEAGILPDVVHTSLQR
RAINTAALALDAADRHWIPVRRSWRLNERHYGALQGKDKAQVRDEYGEEQFMLWRRSFDV
PPPPLDDSDPYSQSGDPRYADLGDELPRAEALKQVIDRLLPYWDAGIVPDLRAGHTVLIA
AHGNSLRAIVKHLDQMSDADITGLNIPTGMPLVYELDEDTLAPVVPGGRYLDPEAAAEAA
AAVANQGR
NT seq 747 nt   +upstreamnt  +downstreamnt
atgacgttcacgctcgtcctgctccgccacggcgagagcgagtggaacgcgaagaacctc
ttcaccggctgggtcgacgtcgcgctgaccgagaaggggcgcggcgaggcggtccgcggc
ggcgagctcctcgcggaggccggcatcctgccggacgtcgtgcacacctcactgcagcgc
cgcgcgatcaacaccgccgcgctcgcgctcgacgccgccgaccggcactggatcccggtg
cgtcgatcctggcgcctcaacgagcgccactacggcgccctgcaaggcaaggacaaggcc
caggtccgcgacgagtacggcgaggagcagttcatgctctggcgccgctcgttcgacgtc
cccccgccgccgctggacgacagcgacccctactcgcagtccggtgacccgcgctacgcc
gacctcggcgacgagctgccccgcgcggaggcgctcaagcaggtcatcgaccggctgctc
ccctactgggacgccggcatcgtgccggacctgcgcgccggccacaccgtcctcatcgcg
gcccacggcaacagcctgcgcgcgatcgtcaagcacctcgaccagatgagcgacgccgac
atcaccggcctcaacatccccaccgggatgccgctggtctacgagctcgacgaggacacc
ctcgccccggtcgtccccggtggccgctacctcgaccccgaggccgccgccgaggctgct
gccgccgtcgccaaccagggccgctga

DBGET integrated database retrieval system