KEGG   Nocardioides sp. WV_118_6: ABFU82_14750
Entry
ABFU82_14750      CDS       T10638                                 
Name
(GenBank) phosphoglyceromutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
nocw  Nocardioides sp. WV_118_6
Pathway
nocw00010  Glycolysis / Gluconeogenesis
nocw00260  Glycine, serine and threonine metabolism
nocw00680  Methane metabolism
nocw01100  Metabolic pathways
nocw01110  Biosynthesis of secondary metabolites
nocw01120  Microbial metabolism in diverse environments
nocw01200  Carbon metabolism
nocw01230  Biosynthesis of amino acids
Module
nocw_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
nocw_M00002  Glycolysis, core module involving three-carbon compounds
nocw_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:nocw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ABFU82_14750
  09102 Energy metabolism
   00680 Methane metabolism
    ABFU82_14750
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ABFU82_14750
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:nocw04131]
    ABFU82_14750
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:nocw04147]
    ABFU82_14750
Enzymes [BR:nocw01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     ABFU82_14750
Membrane trafficking [BR:nocw04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    ABFU82_14750
Exosome [BR:nocw04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   ABFU82_14750
  Exosomal proteins of melanoma cells
   ABFU82_14750
SSDB
Motif
Pfam: His_Phos_1
Other DBs
NCBI-ProteinID: XBB65370
LinkDB
Position
3029454..3030200
AA seq 248 aa
MTFTLVLLRHGESEWNAKNLFTGWVDVALTEKGRGEAVRGGDLLKEAGILPDVVHTSLQR
RAINTAALALDAADRHWIPVRRSWRLNERHYGALQGKDKKSIKDEYGEEQFMLWRRSFDT
PPPPLADDDEYSQSGDPRYADLGDELPRAEALKQVIDRLLPYWDAGIVPDLRAGHTVLVA
AHGNSLRAIVKHLDQVSDTDIAGLNIPTGMPLVYELDEDTLAPTVPGGRYLDPEAAAAAA
AAVANQGR
NT seq 747 nt   +upstreamnt  +downstreamnt
atgaccttcaccctggtcctgctccgccacggcgagagcgagtggaacgccaagaacctc
ttcaccggctgggtcgacgtggccctgaccgagaagggccggggcgaggcggtccgcggg
ggcgacctcctcaaggaggccggcatcctgcccgacgtcgtgcacacctcgctccagcgc
cgcgcgatcaacacggccgcgctggcgctcgacgccgccgaccggcactggatcccggtc
cgccgctcctggcgcctcaacgagcgccactacggcgccctgcagggcaaggacaagaag
tccatcaaggacgagtacggcgaggagcagttcatgctctggcgccgctccttcgacacc
ccgccgccgccgctggccgacgacgacgagtactcccagtccggtgacccccgctacgcc
gacctcggcgacgagctgccccgcgccgaggcgctcaagcaggtcatcgaccggctgctg
ccctactgggacgccgggatcgtgccggacctgcgcgccgggcacaccgtgctcgtcgcc
gcccacggcaacagcctgcgcgcgatcgtcaagcacctcgaccaggtcagcgacaccgac
atcgccgggctcaacatccccaccggcatgccgctggtctacgagctcgacgaggacacc
ctcgcgccgaccgtcccgggcgggcgctacctcgaccccgaggccgctgccgcggccgcg
gcggccgtggccaaccagggtcgctga

DBGET integrated database retrieval system