Nocardia otitidiscaviarum: FOH10_04170 Help Entry FOH10_04170       CDS       T06114                                  Name (GenBank) mycoredoxin   KO K18917   mycoredoxin [EC:1.20.4.3] Organism nod  Nocardia otitidiscaviarum Brite KEGG Orthology (KO) [BR:nod00001]  09190 Not Included in Pathway or Brite   09191 Unclassified: metabolism    99980 Enzymes with EC numbers     FOH10_04170 Enzymes [BR:nod01000]  1. Oxidoreductases   1.20  Acting on phosphorus or arsenic in donors    1.20.4  With disulfide as acceptor     1.20.4.3  mycoredoxin      FOH10_04170 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin GST_N_2 Glrx-like GST_N_3 Thioredoxin_2 Thioredoxin Motif Other DBs NCBI-ProteinID:  QDP83197 UniProt:  A0A516NWB6 LinkDB All DBs Position complement(954031..954261) Genome browser AA seq 76 aa AA seqDB search MYSTTWCGYCRRLRKQLDEAGITYEVIDIEENPAAAEFVGSVNNGNHVVPTVKYRDGSTA TNPSLAAVRQALAAIS NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atgtactcgacgacctggtgcggctactgccgccgactcaggaagcaactcgacgaggcg gggatcacctacgaggtgatcgatatcgaggagaatcccgcggcggccgaattcgtcggc agcgtgaacaacggcaaccacgtggtgccgaccgtgaaatatcgggacgggtccaccgcc accaatcccagcctggccgccgtgcggcaggccctcgccgcgatcagctga

DBGET integrated database retrieval system