Nostoc sp. CENA543: CLI64_25905 Help Entry CLI64_25905       CDS       T05285                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism noe  Nostoc sp. CENA543 Pathway noe01100   Metabolic pathways noe01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:noe00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CLI64_25905    00074 Mycolic acid biosynthesis     CLI64_25905   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CLI64_25905 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L12_N Ribosomal_L50 DUF5783 HLH Motif Other DBs NCBI-ProteinID:  AUT03562 UniProt:  A0A2I8AE00 LinkDB All DBs Position 6218534..6218785 Genome browser AA seq 83 aa AA seqDB search MSQTETFEKVKAIVADQLSVEEEKITPQANFANDLGADSLDTVELVMALEEEFDIEIPDE AAEKITTVQEAVDYINSKVAASA NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atgagtcaaacagagacatttgaaaaagtcaaggcaattgttgccgaccaactcagtgta gaagaggaaaaaatcacaccacaggcaaattttgccaatgatctaggggcagattcctta gatacagtggaattagttatggctttggaagaagaatttgacatcgaaattcccgatgaa gccgccgaaaaaatcacaaccgttcaagaagcagtggattacatcaacagtaaagttgcc gcatctgcttaa

DBGET integrated database retrieval system