Novosphingobium sp. Gsoil 351: GKE62_04225
Help
Entry
GKE62_04225 CDS
T06443
Name
(GenBank) ATP-binding cassette domain-containing protein
KO
K06158
ATP-binding cassette, subfamily F, member 3
Organism
nog
Novosphingobium sp. Gsoil 351
Brite
KEGG Orthology (KO) [BR:
nog00001
]
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03012 Translation factors [BR:
nog03012
]
GKE62_04225
Translation factors [BR:
nog03012
]
Eukaryotic type
Initiation factors
Initiation associated factors
GKE62_04225
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
ABC_tran
ABC_tran_Xtn
AAA_21
SMC_N
AAA_29
AAA_22
MMR_HSR1
AAA
nSTAND3
RNA_helicase
TsaE
NACHT
RsgA_GTPase
ABC_tran_CTD
AAA_15
SbcC_Walker_B
RuvB_N
AAA_28
AAA_13
AAA_25
Motif
Other DBs
NCBI-ProteinID:
QGN53858
LinkDB
All DBs
Position
892753..894618
Genome browser
AA seq
621 aa
AA seq
DB search
MIGISNITVRLGGRTILDGATAALRPGGRYGLIGRNGAGKSTLMKVLIGQLDPDGGSIEI
PRKARLGYIAQDAPGGTTTPFDLVLAADSERAALLDEAEHCHDAHRLGDIHDRLLAIDAY
TAPSRAAIILTGLGFDETMQAQPLDSFSGGWKMRVALAALLFSAPDVLLLDEPSNHLDLE
STLWLESFLKSYPGTLIVISHERDLLNNVVDTILHLQGGKLTLYPGDYDSFERQRAERAA
QLAAAKASQDAQRARLQDYVARNSARASTAKQAQSRAKMLAKMQPIAALMEDPSLSFDFP
SPEEMRPPLITLDLAAVGYSETPILKRLNLRIDPDDRIALLGRNGNGKTTLARLLAAQLA
PLAGAMNASSKMEVGYFTQYQVEELAADDTPLEHMTRAMKGATPGAVRAQLGRFGFSGNR
ATTRVGQLSGGERARLALALITRDAPHLLILDEPTNHLDVDAREALVQALNAFDGAVILI
SHDRHMVELTADRLVLVDDGTAVDYPGSVSDYIDFVLGRNQPKGEARTKGAKKDRKAVAQ
AREDARQAAKEVADAEAAIAGLQAQVSAIDRAMFDPATAEPALANLKMGDLVAKRTALAR
ELQRAEDRWLAASERREAEAA
NT seq
1866 nt
NT seq
+upstream
nt +downstream
nt
atgatcggcatctccaacatcaccgtgcgccttggcgggcgcacgatcctcgacggggcg
accgcggcgctgcgtcccggtgggcgctatggcctgatcgggcgcaacggcgcgggcaag
tcgacgctgatgaaggtgctgatcggtcagctcgatcccgatggcggctcgatcgagatc
ccgcgcaaggcgaggctcggctacatcgcgcaggatgcgccgggcggcaccaccaccccg
ttcgacctcgtgctcgccgccgatagcgagcgcgccgcgctgctcgacgaggccgagcat
tgccacgacgcccaccgcctcggcgacatccacgaccgcctgttggcgatcgacgcctac
accgcgccctcgcgcgccgcgatcatcctgaccggtctcggcttcgacgagacgatgcag
gcgcagccgctcgacagcttttcgggcgggtggaagatgcgcgtggcgctggccgcgctg
ctgttctcggcccccgacgtgctgctgctcgacgagccttcgaaccacctcgatctggaa
tcgacgctttggctggaaagcttcctcaagagctatcccggcacgctgatcgtcatcagc
cacgagcgtgacctgctcaacaacgtggtcgataccatcctccacctccaaggcggcaag
ctgacgctgtaccccggcgattacgacagcttcgaacgccagcgcgccgaacgcgccgcg
cagctcgccgcggcgaaggccagccaggacgcgcagcgcgcacggttgcaggattacgtc
gcgcgcaacagcgcgcgcgcctccaccgccaagcaggcgcagtcgcgcgccaagatgctg
gccaagatgcagccgatcgccgcactgatggaggatcccagcctcagcttcgatttcccc
agcccggaggagatgcgcccgccgctgatcacgctcgatctcgcggcggtcggttatagc
gaaacgccgatcctcaagcggcttaacctgcggatcgatcccgacgaccggatcgcgttg
ctcgggcgcaacggcaacggcaagaccacgctggcgcggctgctggcggcgcaattggcc
ccgctggccggcgcgatgaacgcctcgagcaagatggaagtcggctatttcacccagtac
caggtggaagagctggcggcggatgacaccccgctcgagcacatgacccgggcgatgaaa
ggggccacccccggcgcggtgcgcgcccagctcgggcggttcggcttttcgggcaaccgc
gcgaccacccgtgtcggccagctttcgggcggcgagcgcgcgcggttggcgctggcgctg
attacccgcgacgcgccgcacctgctgatcctcgacgagccgaccaaccacctcgacgtc
gatgcgcgcgaggcgctggtccaggcgctcaacgccttcgacggcgcggtgatcctgatc
agccacgatcgccacatggtcgagctcaccgccgaccggctggtgctggtcgacgacggc
accgcggtcgattaccccggcagcgtcagcgactacatcgacttcgtgctcgggcggaac
caacccaagggcgaggcgcgcacgaagggcgcgaagaaggaccgcaaggccgtcgcccaa
gctcgcgaggatgcgcgccaggcggcgaaggaagtcgccgacgcagaggctgcgatcgcg
ggtttgcaggcccaggtctcggcgatcgatcgggcgatgttcgatccggccactgccgaa
ccggccctggcgaacctcaagatgggcgatctggtcgccaagcgcaccgcgctggcccgc
gaacttcagcgcgcagaggatcgctggctcgccgccagcgagcgccgcgaggccgaagcc
gcgtaa
DBGET
integrated database retrieval system