Novosphingobium sp. Gsoil 351: GKE62_17145 Help Entry GKE62_17145       CDS       T06443                                  Name (GenBank) DNA-binding protein HU   KO K03530   DNA-binding protein HU-beta Organism nog  Novosphingobium sp. Gsoil 351 Brite KEGG Orthology (KO) [BR:nog00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:nog03032]     GKE62_17145    03036 Chromosome and associated proteins [BR:nog03036]     GKE62_17145    03400 DNA repair and recombination proteins [BR:nog03400]     GKE62_17145 DNA replication proteins [BR:nog03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     GKE62_17145 Chromosome and associated proteins [BR:nog03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     GKE62_17145 DNA repair and recombination proteins [BR:nog03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       GKE62_17145 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 HU-CCDC81_euk_2 DUF2267 VWA_3 GTP_EFTU_D2 HU-CCDC81_euk_1 Motif Other DBs NCBI-ProteinID:  QGN56014 UniProt:  A0A6I5X297 LinkDB All DBs Position 3572044..3572316 Genome browser AA seq 90 aa AA seqDB search MNKNDLISAVADSSGLTKGDAMKAVESVFEAISGALKSGDEVRLVGFGTFSVAKRKASTG RNPRTGEPMTIKASTQPKFKAGKGLKDAVN NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgaacaagaacgatctgatcagtgcggtcgccgactcgagcggactgaccaagggtgac gcgatgaaggcggttgaatccgtgttcgaggcgatctcgggcgcgctcaagagcggcgac gaagtgcgcctggtgggcttcggtacgttctcggtagccaagcgcaaggcctcgaccggt cgcaacccgcgcaccggcgagccgatgacgatcaaggcttcgacccagcccaagttcaag gccggcaagggtctgaaggacgcggtcaactaa

DBGET integrated database retrieval system