Nordella sp. HKS 07: G5V57_01455 Help Entry G5V57_01455       CDS       T06462                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism noh  Nordella sp. HKS 07 Pathway noh01100   Metabolic pathways noh01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:noh00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     G5V57_01455    00074 Mycolic acid biosynthesis     G5V57_01455   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     G5V57_01455 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF1493 Motif Other DBs NCBI-ProteinID:  QIG46541 UniProt:  A0A6G6WMI2 LinkDB All DBs Position complement(306377..306625) Genome browser AA seq 82 aa AA seqDB search MSVSEDTFNTLCQLLEPFNTAKIALKPDTDISADLNIDSVTVMDFVMEVEDRFNIDIPLN VLSETRSLGDLVKVVDARLAKV NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atgagcgtgagcgaggacacattcaatacactgtgtcagctgcttgaaccgttcaacacg gccaagatcgccctgaagcccgacacggatatctcagccgatctcaatatcgattccgta acggtcatggatttcgtcatggaagtagaggaccgcttcaacatcgacattcctctcaat gtcctttccgaaacacgctcgcttggcgaccttgtaaaggtcgtcgatgcccggctggca aaggtgtga

DBGET integrated database retrieval system