Nordella sp. HKS 07: G5V57_32645 Help Entry G5V57_32645       CDS       T06462                                  Name (GenBank) sarcosine oxidase subunit delta   KO K00304   sarcosine oxidase, subunit delta [EC:1.5.3.24 1.5.3.1] Organism noh  Nordella sp. HKS 07 Pathway noh00260   Glycine, serine and threonine metabolism noh01100   Metabolic pathways Brite KEGG Orthology (KO) [BR:noh00001]  09100 Metabolism   09105 Amino acid metabolism    00260 Glycine, serine and threonine metabolism     G5V57_32645 Enzymes [BR:noh01000]  1. Oxidoreductases   1.5  Acting on the CH-NH group of donors    1.5.3  With oxygen as acceptor     1.5.3.1  sarcosine oxidase (formaldehyde-forming)      G5V57_32645     1.5.3.24  sarcosine oxidase (5,10-methylenetetrahydrofolate-forming)      G5V57_32645 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  SoxD Lar_restr_allev Motif Other DBs NCBI-ProteinID:  QIG52037 UniProt:  A0A6G6X3L3 LinkDB All DBs Position 6888633..6888902 Genome browser AA seq 89 aa AA seqDB search MQIFICPFCGPREESEFHYGGDAGNARPEGADVPAERWGDYLYMRNNPKGAAREVWVHMA CGEFFVMERDSVGHTVTATHALTDGKHPE NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgcagatattcatttgtcccttctgtggcccgcgcgaggaaagcgaattccactatggc ggcgatgccggcaatgcgcgccccgaaggcgccgatgtgccggccgaacgctggggggac tacctttacatgcgcaataatccgaagggtgccgcccgcgaggtctgggtccacatggct tgcggcgaattcttcgtgatggagcgtgacagcgtcggccacaccgtcaccgcgacgcac gcgctcacagatggaaagcaccccgaatga

DBGET integrated database retrieval system