Noviherbaspirillum sp. UKPF54: FAY22_14185 Help Entry FAY22_14185       CDS       T06116                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism nok  Noviherbaspirillum sp. UKPF54 Pathway nok01100   Metabolic pathways nok01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:nok00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     FAY22_14185    00074 Mycolic acid biosynthesis     FAY22_14185   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     FAY22_14185 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  QDZ29005 UniProt:  A0A5B8N7K1 LinkDB All DBs Position 3087398..3087646 Genome browser AA seq 82 aa AA seqDB search MQRLDEVRNMLAEVLGLGERKKFLSADSTLLGALPELDSMAVISVISALEEWFGIAVDDD EINANIFRTLGSLTNFVDQKLA NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atgcagcgtcttgacgaagtaagaaacatgctcgccgaggttctcggcctgggtgagcgc aagaaatttctgagtgcggactcaacgctgctgggggccttgccggagctggattcgatg gcggtaatcagcgtcatttcggcactggaggagtggttcggcatcgcggtggacgacgac gaaatcaatgcgaacatcttccgtaccctgggaagcctcacgaacttcgtcgaccagaag cttgcataa

DBGET integrated database retrieval system