Novosphingobium olei: NSDW_24010 Help Entry NSDW_24010        CDS       T09939                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism nol  Novosphingobium olei Pathway nol01100   Metabolic pathways nol01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:nol00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     NSDW_24010    00074 Mycolic acid biosynthesis     NSDW_24010   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     NSDW_24010 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding ACP_SdgA_C PP-binding_2 Ribosomal_L12_N DUF1493 DUF5783 Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  BEV01307 LinkDB All DBs Position complement(2590429..2590665) Genome browser AA seq 78 aa AA seqDB search MSDTADRVKKIVVEHLGVEAEKVTEDASFIDDLGADSLDIVELVMAFEEEFGVEIPDDAA EKIATVSDAIKYIDENKG NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcgataccgccgaccgcgttaagaagatcgtcgtcgagcacctgggcgtcgaggcc gagaaggtcaccgaagatgccagcttcatcgacgacctgggcgccgactcgctcgacatc gtcgagctggtcatggcgttcgaggaagaattcggcgtcgaaatcccggacgatgcggcc gagaagatcgccaccgtctcggacgcgatcaagtacatcgacgaaaacaagggctga

DBGET integrated database retrieval system