Novosphingobium sp. EMRT-2: FA702_05120
Help
Entry
FA702_05120 CDS
T06038
Symbol
phoB
Name
(GenBank) phosphate regulon transcriptional regulatory protein PhoB
KO
K07657
two-component system, OmpR family, phosphate regulon response regulator PhoB
Organism
nor
Novosphingobium sp. EMRT-2
Pathway
nor02020
Two-component system
Brite
KEGG Orthology (KO) [BR:
nor00001
]
09130 Environmental Information Processing
09132 Signal transduction
02020 Two-component system
FA702_05120 (phoB)
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
02022 Two-component system [BR:
nor02022
]
FA702_05120 (phoB)
Two-component system [BR:
nor02022
]
OmpR family
PhoR-PhoB (phosphate starvation response)
FA702_05120 (phoB)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Response_reg
Trans_reg_C
HTH_20
PDE8A_N
Motif
Other DBs
NCBI-ProteinID:
QCI92992
LinkDB
All DBs
Position
1031195..1031884
Genome browser
AA seq
229 aa
AA seq
DB search
MSAPKLLLVEDDTALAELVEYRFRGEGYDVRTTDDGDEALLLAAEDTPDLVLLDWMIGGT
SGIEVCRRLRRNKSTAHVPIIMLTARSDEDDRVRGLETGADDYVTKPFSPRELIARVGAV
LRRVRPALAGETITVGDLSLDPTAHRVTRRGQAIKIGPTEFRLLRHFMEHPGRVFSRGQL
LDAVWGSGSDIELRTVDVHIRRLRQAIALPGAADPVRTVRSAGYALEGA
NT seq
690 nt
NT seq
+upstream
nt +downstream
nt
gtgtctgccccgaaactgcttctggttgaagacgataccgcgcttgccgaactggtcgaa
taccggtttcgtggcgagggatacgacgtgcgcaccaccgacgatggcgacgaggccctg
cttctcgccgccgaggatacgccggacctggtcctgctggactggatgatcggtggcacc
agcggaatcgaggtctgccgccgcctgcgccgcaacaagagcacggcgcatgtgccgatc
atcatgctcaccgcccgcagcgatgaggacgaccgcgtgcgcgggctggaaaccggcgcg
gacgactatgtcaccaagccgttctcgccgcgcgaactgattgcccgcgtgggcgccgtg
ctgcgtcgcgtgcgcccggcactggcgggagagacgatcaccgtgggcgatctgtcgctc
gatcccaccgcccaccgcgtcacccgccgcgggcaggcgatcaagatcggccccaccgaa
ttccgcctgctgcgccacttcatggagcaccccggccgcgtcttttcgcgcgggcaactg
ctcgacgcggtgtggggcagcggcagcgacatcgaactgcgcacggtggacgttcacatc
cgccgcctgcgccaagcgatcgcgctccccggagcggccgacccggtgcgcacggtgcgt
tcggcgggctacgcgctggaaggcgcctga
DBGET
integrated database retrieval system