Novosphingobium sp. EMRT-2: FA702_08120 Help Entry FA702_08120       CDS       T06038                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism nor  Novosphingobium sp. EMRT-2 Pathway nor01100   Metabolic pathways nor01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:nor00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     FA702_08120    00074 Mycolic acid biosynthesis     FA702_08120   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     FA702_08120 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  QCI93526 UniProt:  A0A4D7DFJ3 LinkDB All DBs Position 1647410..1647649 Genome browser AA seq 79 aa AA seqDB search MDRAATANRIAELIEPFNKKGIAIAEGTTFAGDLEWDSLTVMDFVAAIEDEFDIIISMNQ QAEIETYGQLIDAVTKLQG NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggaccgcgccgcaaccgccaaccggatcgccgagctgatcgagccgttcaacaagaag ggcatcgcgatcgccgaggggacgacctttgccggcgaccttgaatgggacagcctgacg gtgatggacttcgtggcggccatcgaggacgaattcgacatcatcatcagcatgaaccag caggccgagatcgaaacctacggccagctgatcgatgccgtgaccaaactgcaaggctga

DBGET integrated database retrieval system