Novosphingobium sp. EMRT-2: FA702_12410 Help Entry FA702_12410       CDS       T06038                                  Name (GenBank) molecular chaperone DnaJ   KO K09539   DnaJ homolog subfamily C member 19 Organism nor  Novosphingobium sp. EMRT-2 Brite KEGG Orthology (KO) [BR:nor00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:nor03110]     FA702_12410    03029 Mitochondrial biogenesis [BR:nor03029]     FA702_12410 Chaperones and folding catalysts [BR:nor03110]  Heat shock proteins   HSP40 / DNAJ    FA702_12410 Mitochondrial biogenesis [BR:nor03029]  Mitochondrial protein import machinery   Matrix    MMC/PAM proteins     FA702_12410 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DnaJ Motif Other DBs NCBI-ProteinID:  QCI94267 LinkDB All DBs Position complement(2522796..2523080) Genome browser AA seq 94 aa AA seqDB search MIKLIWLAFLVSVAVRLLAGRWPWELWRDSGRASAETRARALLGVPPQASRDDIVEAHRR RIAQVHPDRGGTAEAVHEANAARDLLLGRLAERR NT seq 285 nt NT seq  +upstreamnt  +downstreamnt atgatcaaactgatctggctcgcgttcctggtcagcgtcgcggtgcgattgctagccggg cgctggccatgggagctgtggcgcgacagcgggcgcgccagtgccgaaacccgtgcgcgc gcccttctgggcgtgcccccgcaagcctcgcgcgacgatatcgtcgaggcgcatcgccgc cggatcgcgcaagtccatccggatcgtggcggcacggcggaagcggtgcacgaagccaac gccgcgcgcgatcttctgctcgggcggctggcggaacggcggtga

DBGET integrated database retrieval system