Novosphingobium sp. EMRT-2: FA702_14720
Help
Entry
FA702_14720 CDS
T06038
Symbol
smc
Name
(GenBank) chromosome segregation protein SMC
KO
K03529
chromosome segregation protein
Organism
nor
Novosphingobium sp. EMRT-2
Brite
KEGG Orthology (KO) [BR:
nor00001
]
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03036 Chromosome and associated proteins [BR:
nor03036
]
FA702_14720 (smc)
Chromosome and associated proteins [BR:
nor03036
]
Prokaryotic type
Chromosome partitioning proteins
Condensin-like complex
FA702_14720 (smc)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
SMC_N
AAA_23
AAA_21
AAA_15
ABC_tran
AAA_29
PUMA_CC
Motif
Other DBs
NCBI-ProteinID:
QCI94654
LinkDB
All DBs
Position
complement(2996916..3000350)
Genome browser
AA seq
1144 aa
AA seq
DB search
MEFRRLKLTGFKSFVEPAELRIEPGLTGIVGPNGCGKSNLLEAIRWVMGESSARSMRGGG
MEDVIFAGTTQRPARAFAEVTLTATTDPSGPFGDELEVVRRIERGAGSAYRVNGKDVRAK
DVALVFADAATGAHSPALVSQGRIAAVIAARPAERRMMLEEAAGIAGLHVRRRDAEQKLR
ATETNLERLVDLLAGLEGQIATLRRQARAADRYKAVSERIRVAEARMVFARWRDAADAAD
AARREAKASEEAVVSAQAAARAAQLAQHAAAAALAEARDDLFDRRQDASAHGQRMASLTT
QLEAAEQRLADLDRQLQRLDDDRTHADRMTEDAAEALTRLEDDIAAAEATLAADEAQRPR
LAAAQDDADRAARSAEVTLAQRVAEQAGIDADWRVAEAAVTAARQLCERHDAEAARLRQQ
VDQLAREGDPGAQIAAAEARRAEAAAALATAQAERTELLALRENLTAERDHAGSALAAAR
AELAGVEREHDALARDKAARERQAAGGHGTTALAALRVAPGFERAVAAVLGRDAGAPVGP
APADADGRFWTGAQVDAALPYSLLHHVPQCPPELAARFGLVRVVDRDEGQALAPGEWLVT
RTGYLRRWDGFVARGEGAAEAATLEAENRLIDLAARLPALRDAVSEAEAAAETARAALAD
AQARLGTAERTMTAAADAERAALRALDQAEAARARAEARRAELDRALAELAERQADGATE
LASAEAKRAALPDPAAGRAAVEAARTRNDAARAALQTASAAIAALEQGLAVGRERLGTHR
ADIRNWQARASDAAKRLADMAGRREEVERERAISAARPAALLREIEDAESIRTRLGQELA
LAEAALTGADAAAKAADAALGAANETLAAARERRAGAVARAESDDTRRQEMASLSGERFQ
CPPPLLPERFDFASGDIGNAAEETTRHDLLIAERERIGPVNLLAADELAEAEDRHGASIT
EQAELTEAVHRLRGSIGNLNREGRERLRAAFEAVDGHFRHLFSRLFGGGEAHLALVDSDD
PLEAGLEIFAQPPGKRLQSLTLLSGGEQALTAVALIFALFLTNPAPICVLDEVDAPLDDA
NVERFCDMLDAMVSETQTRYLIVTHNAVTMSRMHRLFGVTMVEKGVSRLVSVDLGAAEEL
LATA
NT seq
3435 nt
NT seq
+upstream
nt +downstream
nt
atggaattcaggcgcttgaagctgaccggcttcaagagctttgtggaacctgctgaactc
cggatcgaaccggggttgacgggtattgtcggccccaacggttgcggaaaatcgaacctg
ctggaagcaatccgctgggtcatgggtgaaagctcggcccggtcgatgcgcggtggcggc
atggaagacgtgatcttcgccggcaccacccagcgcccggcgcgcgccttcgccgaagtg
acgctgaccgccacgaccgatccctccggtccgttcggcgacgagctggaagtggtgcgc
cggatcgaacgcggcgcgggcagcgcctatcgcgtcaacggcaaggacgtgcgcgccaag
gacgtggcgctggtcttcgccgatgccgccaccggcgcgcacagcccggcgctggtcagc
cagggccgcatcgcggcggtgatcgccgcgcgccccgccgaacggcgcatgatgctggag
gaagcggcggggatcgccggcctccacgtccgccggcgcgatgccgaacagaagctgcgc
gccaccgaaaccaatcttgaacggctggtggacctgctcgccgggctggaaggccagatc
gccacgctgcgccggcaggcccgcgccgccgatcgctacaaggcggtgagcgaacgcatc
cgcgtggccgaggcgcgcatggtctttgcccgctggcgcgatgcggcggacgcggcggac
gcggcgcggcgggaagcgaaggccagcgaggaggccgtcgtcagcgcgcaggccgccgcg
cgcgcggcccagctggcgcaacatgccgccgccgccgcgctggccgaagcgcgcgacgat
ctgttcgatcgccggcaggacgcgtcggcacatggccagcgcatggcctcgctgaccacc
cagctggaggcggccgagcaacggctggccgaccttgaccggcagctgcagcggctggac
gacgatcgtacccacgccgaccgcatgaccgaggacgcggccgaagcgctcacccggctg
gaagacgacattgccgccgccgaagcaacgctcgcggcggacgaggcccagcggccgcgc
cttgccgccgcgcaggacgatgccgatcgcgccgcgcgttccgccgaagtcacgctggcg
cagcgcgtggccgaacaggccggaatcgatgccgactggcgcgtggcggaagcggccgtc
acggcggcccgccagctgtgcgaacggcacgacgccgaagcggcgcggctgcggcagcag
gtcgatcaactggcgcgcgagggcgatcccggcgcgcagatcgcggcggcagaggcccgg
cgcgccgaagcagccgccgcgctcgccacggcgcaagcggagcggacggagctgctggcg
ctgcgcgaaaacctgaccgccgaacgcgatcacgccggcagcgcgctcgccgccgcgcgc
gccgaactcgccggggtggagcgcgaacacgatgccctcgcccgcgacaaggccgcgcgc
gaacgccaggccgccggcgggcacggcaccaccgcgctggccgcgctgcgcgtggcgccg
ggcttcgagcgcgccgtcgccgccgtgctggggcgcgatgccggcgcgccggtaggcccc
gccccggcggatgccgacgggcgcttctggaccggcgcgcaagtcgatgccgcgctgccc
tattcgctgctgcaccatgtgccgcagtgcccgcccgaactggcggcgcgcttcgggctg
gtgcgcgtggtcgatcgcgacgaggggcaggcgcttgcccccggcgaatggctggtgacg
cgcaccggatacctgcggcgctgggacggctttgtcgcgcgcggcgaaggcgcggccgaa
gcggccacgctggaagcggagaaccggctgatcgacctcgccgcgcggctgcccgcgctg
cgcgatgcagtgagcgaagcggaagcagctgccgagacggcgcgcgcggcgctggccgac
gcgcaagcccggctgggcacggccgaacgcaccatgaccgcggctgcggatgccgagcgc
gcggcgctgcgcgcgctggaccaggccgaagccgcccgcgcccgcgcggaagcccgccgc
gcagaactcgatcgcgcgctcgccgagctggccgagcgccaggccgatggcgcaaccgag
ctggccagcgccgaggccaagcgcgcggccctgcccgatcccgctgccgggcgtgccgcc
gtcgaagcggcgcggacgcgcaacgatgccgcgcgggcggctctgcagacggcttcggcg
gccatcgccgcgctggagcagggacttgccgtcgggcgcgagcggctgggcacgcaccgg
gcggacatccgcaactggcaggcacgcgccagcgacgcggcaaagcggctggcggacatg
gcgggccggcgcgaggaggtggaacgcgaacgcgcgatcagcgccgcgcggcccgccgcc
ttgctgcgcgagatcgaggatgccgaatcgatccgcacgcggctgggccaggaactggcg
ctggccgaagccgcactgactggtgcggatgccgccgcgaaggccgccgacgcggcgctg
ggcgcggccaacgaaacgctcgccgccgcgcgcgaacggcgcgccggcgcggtggctcgc
gccgagagcgacgacacacgccggcaggaaatggccagcctttcgggcgaacgattccag
tgcccgccaccgctgctgcccgaacgcttcgacttcgcctctggcgatatcggcaacgcg
gccgaggaaaccacgcggcacgatctgctgatcgccgaacgcgaacgcatcggcccggtc
aacctgctcgccgccgacgaactggccgaggctgaggaccgccacggcgccagcatcacc
gaacaggccgaactgaccgaggcggtgcaccgcctgcgcggatcgatcggcaatctcaac
cgcgaggggcgcgaacgcctgcgcgccgcgttcgaggcggtggacggccacttccgccac
ctgttttcgcgcctgttcggcggcggcgaggcgcatctggcgctggtggacagcgatgat
ccgctggaagcgggcctcgaaatcttcgcccagccgccgggcaagcgcctgcaatcgctg
acgctgctgtcgggcggcgaacaggcgctgaccgccgtggcgctgatcttcgcgctgttc
ctcaccaaccccgcgccgatctgcgtgctcgacgaagtggacgccccgctcgacgacgcc
aacgtcgaacgcttctgcgacatgctcgacgcgatggtcagcgaaacccagacccgctac
ctcatcgtcacccacaacgcggtcacgatgagccgaatgcaccgcctgttcggcgtaacc
atggtcgaaaagggcgtctcgcggctggtcagcgtggatcttggcgcggccgaggaattg
ctggcgacggcctga
DBGET
integrated database retrieval system