Novosphingobium sp. EMRT-2: FA702_17645 Help Entry FA702_17645       CDS       T06038                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism nor  Novosphingobium sp. EMRT-2 Brite KEGG Orthology (KO) [BR:nor00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:nor03032]     FA702_17645    03036 Chromosome and associated proteins [BR:nor03036]     FA702_17645    03400 DNA repair and recombination proteins [BR:nor03400]     FA702_17645 DNA replication proteins [BR:nor03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     FA702_17645 Chromosome and associated proteins [BR:nor03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     FA702_17645 DNA repair and recombination proteins [BR:nor03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       FA702_17645 SSDB OrthologParalogGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 HU-CCDC81_euk_2 HU-CCDC81_euk_1 DUF2267 VWA_3 Motif Other DBs NCBI-ProteinID:  QCI95150 LinkDB All DBs Position 3649293..3649565 Genome browser AA seq 90 aa AA seqDB search MNKNDLISAVADASGLSKGDATKAVEAVFESISGALSKGDEVRLVGFGTFSVAKRKASTG RNPRTGEPMSIKASSQPKFKAGKGLKDAVN NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgaacaaaaacgatttgatcagcgctgtcgccgatgccagcggcctctcgaagggtgat gccacgaaggcggtggaagccgttttcgaatccatctccggggcgctctcgaagggcgac gaagtgcgtctggtcggttttggcacgttctcggtcgccaagcgcaaggcttcgaccggc cgtaacccgcgcacgggcgagccgatgtcgatcaaggcctcgtcgcagccgaagttcaag gcgggcaagggcctgaaggacgcggtgaactga

DBGET integrated database retrieval system