Nostoc sp. UHCC 0870: L6494_03600 Help Entry L6494_03600       CDS       T11470                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism nosc  Nostoc sp. UHCC 0870 Pathway nosc00998   Biosynthesis of various antibiotics nosc01100   Metabolic pathways nosc01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:nosc00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     L6494_03600 (acpP)    00074 Mycolic acid biosynthesis     L6494_03600 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     L6494_03600 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Other DBs NCBI-ProteinID:  UKO98826 LinkDB All DBs Position complement(843142..843393) Genome browser AA seq 83 aa AA seqDB search MSQAEIFAQVKKIIVDQLSVDEEKVTETANFANDLGADSLDTVELVMALEEEFDIEIPDE AAEKITTVQEAVDYINSKVAASA NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atgagccaggcagaaatctttgcacaagtcaagaaaatcattgtcgatcaacttagtgtt gacgaggaaaaagttaccgaaacagcaaattttgctaacgatttaggggcagattcccta gatacagtggaattagtaatggctttggaagaagaatttgatatcgaaattcccgatgaa gccgccgaaaaaattacaaccgttcaagaagcagtggattacatcaacagcaaagttgcc gcatccgcttaa

DBGET integrated database retrieval system