Nostoc sp. ATCC 53789: GJB62_21845 Help Entry GJB62_21845       CDS       T10687                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism nost  Nostoc sp. ATCC 53789 Pathway nost00998   Biosynthesis of various antibiotics nost01100   Metabolic pathways nost01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:nost00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     GJB62_21845 (acpP)    00074 Mycolic acid biosynthesis     GJB62_21845 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     GJB62_21845 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L12_N DUF6137 DUF1896 Motif Other DBs NCBI-ProteinID:  QHG18355 LinkDB All DBs Position complement(5278527..5278781) Genome browser AA seq 84 aa AA seqDB search MSQTELFEKVKKIVIEQLSVEDASKITPQAKFMEDLGADSLDTVELVMALEEEFDIEIPD EAAEQIVSVQDAVDYINNKVAASA NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atgagccaaacggaactttttgaaaaggtcaagaaaatcgtcatcgaacaactgagtgtt gaagatgcttccaaaatcactccacaagctaagtttatggaagatttaggagctgattcc ctggatactgttgaactcgtgatggctttggaagaagaatttgatatcgaaattcccgac gaagctgccgagcagattgtatcggttcaagacgcagtagattacatcaataacaaagtt gctgcatcagcttaa

DBGET integrated database retrieval system