Novosphingobium sp. THN1: C7W88_01980 Help Entry C7W88_01980       CDS       T05635                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism not  Novosphingobium sp. THN1 Pathway not01100   Metabolic pathways not01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:not00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     C7W88_01980    00074 Mycolic acid biosynthesis     C7W88_01980   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     C7W88_01980 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  AXU18099 LinkDB All DBs Position 393123..393362 Genome browser AA seq 79 aa AA seqDB search MDRAATAEKIAELIEPFNKKGIAITEATTFAGDLEWDSLTVMDFVAAIEDDFDIIISMNQ QAEIETYGQLIDAVTKLQG NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggatcgcgccgcaaccgccgaaaagatcgccgaactgatcgaacccttcaacaagaag ggcatcgcaattaccgaagcgaccacttttgccggcgatcttgagtgggacagcctgacg gtgatggacttcgtcgcggccatcgaggacgacttcgacatcatcatcagcatgaaccag caagccgagatcgagacctatggccagttgatcgatgcggtgacgaagctccagggctga

DBGET integrated database retrieval system