Novosphingobium sp. THN1: C7W88_09195 Help Entry C7W88_09195       CDS       T05635                                  Name (GenBank) F0F1 ATP synthase subunit C   KO K02110   F-type H+-transporting ATPase subunit c Organism not  Novosphingobium sp. THN1 Pathway not00190   Oxidative phosphorylation not01100   Metabolic pathways Module not_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:not00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     C7W88_09195  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:not00194]     C7W88_09195 Photosynthesis proteins [BR:not00194]  Photosystem and electron transport system   F-type ATPase [OT]    C7W88_09195 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_C Motif Other DBs NCBI-ProteinID:  AXU19167 LinkDB All DBs Position 1840228..1840455 Genome browser AA seq 75 aa AA seqDB search MDAESAKLLGAGLAAVGAGLASLGVGNVFAKFLEGALRNPGAADGQQGRLFIGFAAAELL GLLSFVVAMILIFVA NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atggacgcagaaagcgcaaagctgctcggtgctggtctcgccgctgttggcgccggtctc gcctcgctgggcgtgggcaacgtgtttgccaagttcctcgaaggcgcgctgcgcaacccc ggagccgctgacggccagcagggccgcctgttcatcggcttcgccgccgccgaacttctg ggcctgctctcgttcgtcgtcgcgatgatcctgatcttcgttgcctaa

DBGET integrated database retrieval system