Natronococcus occultus: Natoc_2152 Help Entry Natoc_2152        CDS       T02426                                  Name (GenBank) ribosomal protein S27AE   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism nou  Natronococcus occultus Pathway nou03010   Ribosome Brite KEGG Orthology (KO) [BR:nou00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     Natoc_2152   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     Natoc_2152  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:nou03011]     Natoc_2152    04121 Ubiquitin system [BR:nou04121]     Natoc_2152   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:nou04147]     Natoc_2152 Ribosome [BR:nou03011]  Ribosomal proteins   Eukaryotes    Small subunit     Natoc_2152   Archaea     Natoc_2152 Ubiquitin system [BR:nou04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    Natoc_2152 Exosome [BR:nou04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    Natoc_2152   Exosomal proteins of colorectal cancer cells    Natoc_2152 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_S27 Zn_ribbon_Nudix Zn_ribbon_IS1595 FYVE Zn_ribbon_RPB9 Anti-TRAP zf-C2H2_FBX41 Motif Other DBs NCBI-ProteinID:  AGB37935 UniProt:  L0K066 LinkDB All DBs Position 2070229..2070363 Genome browser AA seq 44 aa AA seqDB search MARHELYGDDGTTDREQCPRCGDSFLADHGDRLHCGKCSYTEWE NT seq 135 nt NT seq  +upstreamnt  +downstreamnt atggcacgacacgagctctacggcgacgacggcaccaccgatcgagagcagtgtccccgc tgtggcgacagcttccttgcggaccacggtgaccgactgcactgcgggaagtgcagttac accgagtgggagtag

DBGET integrated database retrieval system