Novosphingobium sp. P6W: TQ38_006695 Help Entry TQ38_006695       CDS       T05550                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism nov  Novosphingobium sp. P6W Pathway nov01100   Metabolic pathways nov01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:nov00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     TQ38_006695    00074 Mycolic acid biosynthesis     TQ38_006695   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     TQ38_006695 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding ACP_SdgA_C PP-binding_2 Ribosomal_L12_N Ribosomal_L50 DUF1493 DUF5783 Motif Other DBs NCBI-ProteinID:  AXB76235 LinkDB All DBs Position 1:1384010..1384246 Genome browser AA seq 78 aa AA seqDB search MSDTADRVKKIVVEHLGVEAEKVTEDASFIDDLGADSLDIVELVMAFEEEFGVEIPDDAA EKISTVSDAIKYIEENKG NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcgataccgccgatcgggttaagaagatcgtcgtcgagcatctgggcgttgaagcc gagaaggtcaccgaagacgcaagcttcatcgatgatctgggcgctgactcgctcgacatc gtcgagttggtcatggccttcgaagaagaattcggcgtcgaaatccccgacgacgcagcc gaaaagatcagcaccgtctccgatgccatcaagtacatcgaagagaacaagggctga

DBGET integrated database retrieval system