Novosphingobium sp. P6W: TQ38_017075
Help
Entry
TQ38_017075 CDS
T05550
Symbol
cysW
Name
(GenBank) sulfate ABC transporter permease subunit CysW
KO
K02047
sulfate/thiosulfate transport system permease protein
Organism
nov
Novosphingobium sp. P6W
Pathway
nov00920
Sulfur metabolism
nov02010
ABC transporters
Module
nov_M00616
Sulfate-sulfur assimilation
Brite
KEGG Orthology (KO) [BR:
nov00001
]
09100 Metabolism
09102 Energy metabolism
00920 Sulfur metabolism
TQ38_017075 (cysW)
09130 Environmental Information Processing
09131 Membrane transport
02010 ABC transporters
TQ38_017075 (cysW)
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
02000 Transporters [BR:
nov02000
]
TQ38_017075 (cysW)
Transporters [BR:
nov02000
]
ABC transporters, prokaryotic type
Mineral and organic ion transporters
Sulfate/thiosulfate transporter
TQ38_017075 (cysW)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
BPD_transp_1
DUF2273
Motif
Other DBs
NCBI-ProteinID:
AXB78373
LinkDB
All DBs
Position
2:127203..128036
Genome browser
AA seq
277 aa
AA seq
DB search
MRRSTTESPALQIVLIAIALLFLAFFLALPLVAVFGEALKAGFGPFLDAVTAPDALSAIK
LTLLIAAISVPLNVVFGVAASWAITKFQFPGKSLLISLIDLPFSVSPVVSGLIFVLLFGA
NGWFGPWLAEHDLKIIFAVPGIVLATVFITFPFVARELIPLMMEQGKDEEEAAISLGASG
WQTFRHVTLPNIRWGLLYGVLLCNARAMGEFGAVSVVSGHIRGETNTMPLHVEILYNEYD
FVGAFAVASLLAGLALVTLIAKTVLEWRFNLHGSARH
NT seq
834 nt
NT seq
+upstream
nt +downstream
nt
atgcggcgctcgaccacggaaagccccgcgctacagatcgttctgatcgctatagcgttg
ctgttcctcgctttctttcttgccctgccgctggtcgcagtgttcggcgaggcactcaag
gcgggcttcggcccgttcctcgatgccgtgaccgcgcccgacgcattgtcggccatcaag
ctgacgctgctgatcgccgcgatcagtgtgcccctcaatgtcgtgttcggcgtggcggcg
agctgggcgatcaccaagttccagttcccgggaaaaagcctgctgatctctttgatcgac
ctgcctttctcagtctcaccggtcgtctcgggccttatcttcgtattgttgttcggggcc
aacggctggttcggtccgtggctcgcagagcatgacctgaagatcatattcgcggtgccg
ggcatcgtactcgccaccgtcttcatcaccttccctttcgtcgcgcgcgagctgatcccg
ctgatgatggaacagggcaaggacgaggaggaagccgcgatctcgcttggggcaagcggc
tggcagaccttccgccatgtcacgctgcccaacatccgctggggcctgctttacggcgta
ctgctgtgcaacgcccgcgccatgggcgagttcggcgccgtttcggttgtctccggccac
attcggggagaaaccaatacgatgccgctgcatgtcgagattctctacaacgaatacgac
ttcgtcggcgccttcgcggtcgcctcgctgctcgcaggactggcgctggtgacgctcatc
gccaagaccgtgctggagtggcgcttcaaccttcacgggagtgcacggcattga
DBGET
integrated database retrieval system