Nitrosopumilus oxyclinae: C5F49_02920 Help Entry C5F49_02920       CDS       T06689                                  Name (GenBank) 30S ribosomal protein S27ae   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism nox  Nitrosopumilus oxyclinae Pathway nox03010   Ribosome Brite KEGG Orthology (KO) [BR:nox00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     C5F49_02920   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     C5F49_02920  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:nox03011]     C5F49_02920    04121 Ubiquitin system [BR:nox04121]     C5F49_02920   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:nox04147]     C5F49_02920 Ribosome [BR:nox03011]  Ribosomal proteins   Eukaryotes    Small subunit     C5F49_02920   Archaea     C5F49_02920 Ubiquitin system [BR:nox04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    C5F49_02920 Exosome [BR:nox04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    C5F49_02920   Exosomal proteins of colorectal cancer cells    C5F49_02920 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_S27 Ribosomal_L37e Zn_ribbon_Nudix DUF1451 Cas12f1-like_TNB Ephrin_rec_like NCD3G DZR_2 Zn_ribbon_NUD Motif Other DBs NCBI-ProteinID:  QLH04382 UniProt:  A0A7D5R8J1 LinkDB All DBs Position complement(508392..508577) Genome browser AA seq 61 aa AA seqDB search MPVEKKGKKGSSPSIASYYKVEGDKASRTRKICSRCGKGTFMAQHKDRNTCGKCGLTEFK Q NT seq 186 nt NT seq  +upstreamnt  +downstreamnt atgcctgtagagaaaaaaggtaagaaaggttccagtcctagcattgcatcatattacaaa gtagaaggagacaaagcatcaagaacaagaaaaatatgttctagatgcggtaaaggaact ttcatggcccaacataaagatagaaacacttgtggcaaatgtggtttgacagaatttaaa caataa

DBGET integrated database retrieval system