Nitrosopumilus oxyclinae: C5F49_06380 Help Entry C5F49_06380       CDS       T06689                                  Name (GenBank) 50S ribosomal protein L40e   KO K02927   ubiquitin-large subunit ribosomal protein L40e Organism nox  Nitrosopumilus oxyclinae Pathway nox03010   Ribosome Brite KEGG Orthology (KO) [BR:nox00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     C5F49_06380   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     C5F49_06380  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:nox03011]     C5F49_06380    04121 Ubiquitin system [BR:nox04121]     C5F49_06380 Ribosome [BR:nox03011]  Ribosomal proteins   Eukaryotes    Large subunit     C5F49_06380   Archaea     C5F49_06380 Ubiquitin system [BR:nox04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    C5F49_06380 SSDB OrthologParalogGFIT Motif Pfam:  Ribosomal_L40e DUF7577 DZR zf-tcix DUF8122 Ribosomal_aS21 Zn_ribbon_3 Zn_Ribbon_1 Motif Other DBs NCBI-ProteinID:  QLH04983 UniProt:  A0A7D5RBM5 LinkDB All DBs Position 1102342..1102509 Genome browser AA seq 55 aa AA seqDB search MPITDPEKKRIAQQARLVMRICFKCGARNDIGATRCRKCRNPYLRLKNRNLGVKK NT seq 168 nt NT seq  +upstreamnt  +downstreamnt atgcctattacagatccagaaaagaaacgaattgcacaacaagcacgtcttgtaatgaga atttgcttcaaatgtggagctagaaacgatataggtgctacacgatgtagaaaatgtaga aatccatacttgagattaaagaataggaatctcggggttaagaaatag

DBGET integrated database retrieval system