Nocardia sp. CS682: DMB37_35080 Help Entry DMB37_35080       CDS       T06040                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism noz  Nocardia sp. CS682 Pathway noz00998   Biosynthesis of various antibiotics noz01100   Metabolic pathways noz01110   Biosynthesis of secondary metabolites Module noz_M00885   Meromycolic acid biosynthesis, initiation and elongation FAS II (KasA) Brite KEGG Orthology (KO) [BR:noz00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     DMB37_35080    00074 Mycolic acid biosynthesis     DMB37_35080   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     DMB37_35080 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  QBS44540 LinkDB All DBs Position 7704979..7705284 Genome browser AA seq 101 aa AA seqDB search MATTQEEIVAGIAEIVEEVTGIEAAEVTIEKSFVEDLDIDSLSLVEIAVQLEDRYGAKIP DEDLASLRTVGDAVAYVQKMAAVEPRLAAEMEARFKEGQEN NT seq 306 nt NT seq  +upstreamnt  +downstreamnt gtggctaccacgcaggaagaaatcgtcgcaggcattgcggagatcgtcgaggaggtgacc ggcatcgaggccgccgaggtgacgatcgaaaagtcctttgtcgaggacctggacatcgac tcgctgtcactggtggagatcgccgtgcaactggaggaccgatacggcgcgaagatcccc gatgaggacttggcaagtcttcgaacagtcggcgacgcggtcgcctacgtgcagaagatg gcggccgtagaaccgcggctcgccgcggaaatggaggcgaggttcaaggaagggcaggag aattga

DBGET integrated database retrieval system